bird,pet Flickr Hive Mind pet bird parrot featheryfriday birds animal nature pets yellow parrots Pairs: bird,pet parrot,pet bird,parrot featheryfriday,pet bird,featheryfriday featheryfriday,parrot bird,birds birds,pet animal,pet birds,featheryfriday Users: KoriG _ shootpics Domain Barnyard Ollie_girl nybird Edgar Thissen sansanparrots Saran Vaid Heaven`s Gate (John) adamantine ineedathis (more)
New Flickr tool available (for Flickr users): Flickr Black Magic. See your photos on black, easily.
 Recent   Interesting   Timeline   Advanced 
Outdoor Dreaming! (shesnuckinfuts) Tags: pet bird nature animals cat ginger backyard squirrel wildlife ducks furryfriday animalplanet kentwa sciuruscarolinensis easterngraysquirrel october2006 cc300 cc100 animaladdiction specanimal animalkingdomelite abigfave shesnuckinfuts catdream wannacomeoutandplay ccc51 cat1500 madeintoagreetingcardforavantipress
Goffin Cockatoo at 1 month old (nybird) Tags: pet white cute bird nature birds animal interestingness mosaic interestingness1 feathers adorable parrot aves avi crest exotic cockatoo babybird exoticbird parrots avian petbird avis cmc goffin interestingness2 babybirds amyfav goffincockatoo interestingness4 30000views exoticbirds supershot featheryfriday adorablog interestingnesstop10 awwwthatsthecutestphotoiveseenallweek explore19december05 i500 cacatuagoffini commentonmycuteness nybird stuckincustomsbrilliantcabal nybirds pixelthis nybirdsphotos gettyimagespick
Rembrandt chicken (moggierocket) Tags: portrait pet brown bird eye chicken animal fence square nikon shadows head beak bec chiaroscuro farmanimal fauxvintage themoulinrouge 500x500 firstquality claireobscure thelittledoglaughed artlibre irresistiblebeauty superbmasterpiece diamondclassphotographer flickrtate winner500
A Portrait (Edgar Thissen) Tags: portrait pet bird 20d birds canon explore masked lovebird tika morley agapornis personata pgphotography supershot edgarthissen featheryfriday 20329 flickrsbest animalkingdomelite colorphotoaward avianexcellence diamondclassphotographer bratanesque
Sunshine the lovebird (adamantine) Tags: orange pet cute bird yellow pretty lovely1 beak parrot cage caged tropical lovebird pappagallo papagei loro papagaio perroquet papegaai 123faves petercristofono
Happy Feathery Friday Easter Chicks! (nybird) Tags: pet bird easter babies basket parrot chick chicks cockatiel parrots easterbasket tt1 kodakcx7430 featheryfriday nybird nybirds themeoftheweekcollections pixelthis nybirdsphotos
Ready for our Easter pictures! (nybird) Tags: pet bird easter babies basket 2006 chick chicks petbird quakers quakerparrot easterbasket q1 featheryfriday i500 nybird featheryfriday1 nybirds pixelthis nybirdsphotos
What cha doin' ? (Ollie_girl) Tags: orange pet bird yellow parrot ollie sunconure i500
"Amigo" - Amazona amazonica (eagle1effi) Tags: pet macro bird birds animal closeup amigo amazon colorful framed wildlife parrot icon crop vgel soe haustier picnik sx1 vogel amazona damncool amazone otw amazonica 30faves canonmacro 10faves views100 views800 views200 20faves views600 views400 views300 views1100 views1000 views1500 views2000 100comments orangewinged 25faves platinumphoto citrit theunforgettablepictures servoaf naturemasterclass 3wordcomments qualitypixels 100commentgroup canonpowershotsx1is sx1best fixedstand sacrosankt sx1isbest sx1fave canonsx1referenceshot canonpowershotsx1isreferenceshot
colorful (bangkok_diary) Tags: portrait pet motion male green bird nature animal proud thailand action sony beak feathers feather fancy crown rooster inspire plumage gallusgallus nakornpathom 555v5f 333v3f 222v2f 444v4f 111v1f  777v7f 666v6f thaiflickrmeet bangkokdiary sanamchandrapalace dsct100 sonydsct100
Name That Duck! (Domain Barnyard) Tags: pet pets color cute green bird feet grass birds yellow wow easter lost happy three photo spring team fantastic funny colorful photographer buddies little fuzzy photos web name beak feathers ducks fluffy ducklings pic 2006 canoneos20d photograph ducky newborn cuddly waterfowl quack yello chums tinny beaks waddle partnersincrime threeducks tingey webfeet passingnotes mightyducks workingtogether domainbarnyard pekingducks goingtobewhiteandfluffy surchingducks springduck
My green hottie (Tanya Mass) Tags: pet green bird parrot budgerigar parakeet exquisite kiwi blueribbonwinner top20birdshots abigfave shellparakeet avianexcellence excellenceinavianphotography diamondclassphotographer flickrdiamond theperfectphotographer top20vivid multimegashot tanyamass
Happy Thanksgiving! (KoriG) Tags: thanksgiving pet bird dinner turkey yoda searchthebest parrot diningroom yaddle parrotlet pacificparrotlet featheryfriday isitcannibalisticforaparrotlettopretendtoeataturkey
HAPPY FEATHERY FRIDAY!  Are ya ready?  Let's Go! (Ollie_girl) Tags: pet sun bird ilovenature interesting parrot ollie conure sunconure featheryfriday i500
Happy Birthday Daddy (whatUthinkin) Tags: portrait dog pet bird beautiful kids puppy bristol children interestingness mort pug indiana parrot explore bubba elkhart bestfriends southbend goshen mishawaka naturesfinest bluecrownedconure explored happybirthdaydaddy everythingindiana pugable
seeking out.. (Forgotten memory) Tags: camera pet cute bird canon friend pigeon dove rusty daily liam lovely seeking theunforgettablepictures 100commentgroup
Muffi (Mats&Muffi) Tags: orange pet cats pets bird animal cat orangecat tabby kitty dynax7d muffi cc700 cc400 cc300 cc200 cc100 cc500 cc600 abigfave lofdec07
Athene noctua (digitalTool ) Tags: sardegna italy pet pets bird nature yellow digital canon eos eyes bravo italia sardinia natura giallo owl lightening occhio soe tool animalplanet animali strix rapace naturesfinest civetta blueribbonwinner 10faves rapax rapacenotturno canon100400mm 400d canoneos400d anawesomeshot aplusphoto excellentphotographerawards shardana excapture theperfectphotographer goldstaraward digitaltool peachofashot carlomarrasphotography
In a bit of a bind (KoriG) Tags: pet bird chicken dinner starwars yoda parrot thats darthvader yaddle clonetrooper parrotlet pacificparrotlet
we're off to see the wizard (sansanparrots) Tags: friends dog pet bird pembroke interestingness corgi parrot explore macaw welshcorgi greenwingmacaw kaley featheryfriday
Personata (Edgar Thissen) Tags: portrait pet bird birds closeup parrot lovebird tika agapornis mw personata edgarthissen featheryfriday outstandingshots 36811 specanimal avianexcellence
Yellow Bird (Oriole) (FoNgEtZ) Tags: pet bird animal zoo philippines davao mindanao yellowbird diamondclassphotographer fongetz francistan
good nite kiss to you chiquita (sansanparrots) Tags: orange pet bird birds parrot conure sunconure featheryfriday maroonbelly
Puffy Parrot 4429 (_ shootpics) Tags: pet pets bird nature birds nikon wildlife parrot parrots caique nikond2x featheryfriday abigfave impressedbeauty aplusphoto
Is that me? (Lisa4414) Tags: 2005 pet reflection bird tag3 taggedout geese pond tag2 tag1 lisa maryland goose lookatme kiss2 payitforward squity featheryfriday kiss3 kiss1 kiss4 thebiggestgroup kiss5
The Happy Couple (KoriG) Tags: pet bird yellow engagement couple yoda little pair parrot pearls ring diamond mellowyellow jewlery bling 2009 parrotlet pacificparrotlet featheryfriday featheryfriday1 americanyellow
Oz Flight 8048 (_ shootpics) Tags: pet pets bird nature birds nikon flight parrot macaw parrots macaws blueandgoldmacaw nikond2x featheryfriday avianexcellence 2009billwilson sorryijustdontgettiredofmacawflightshots onemoreofozzycominginlow sheisgettingtobequitetheflyer butstillwillrunyouover
Too Much Hair Gel? (_ shootpics) Tags: pet pets bird birds nikon wildlife parrot macaw parrots blueandgoldmacaw nikond2x featheryfriday abigfave impressedbeauty diamondclassphotographer canneverhavetoomanypets twodogsacatandacaiquewerenotenough thelatestadoption parrotsaregreatforansweringtelemarketingcalls youcanevenprogramthemtoarguewithyourkidsforyou timetobuildanarkanybodyhavetwogiraffes
Cats Eyes (Heaven`s Gate (John)) Tags: pet reflection bird animal cat wow eyes catseyes blueribbonwinner abigfave p1f1
El pequeo pichon (aunqtunolosepas) Tags: portrait pet baby pets macro cute bird love birds animal animals closeup hearts hands hand close bea heart little sweet retrato adorable cutie pajaros mano bebe animales cerca sweetie pajaro lovely cuteness soe mascota mascotas corazon pequeo tinny pajarito feathery feath pajaritos gorrion blueribbonwinner gorriones cercano pequein abigfave aunqtunolosepas platinumheartaward
West stealing my soda and using the straw (pandoraice) Tags: pet pets cute bird birds parrot tricks conure greencheek featheryfriday featherfriday1
New Chick (Domain Barnyard) Tags: 2005 pet baby bird chicken animal spring young chick poultry pollo upclose hatched tingey domainbarnyard
Rose-Ringed Parakeet (Psittacula Krameri) Common Indian Parrot (Saran Vaid) Tags: pet india color green bird nature beautiful beauty birds rose fauna zoo colorful asia alone dof searchthebest bokeh wildlife indian heinrich beak feathers parrot monk cage best depthoffield exotic poultry pirate sit parakeet punjab kramer soe isolated ringed chandigarh captivity birdwatcher wilhelm awesomeshot indianparrot psittaculakrameri roseringedparakeet ringneckedparakeet psittacula flickrsbest krameri rajpura abigfave canoneos400d platinumphoto avianexcellence flickrdiamond theunforgettablepictures commmon canonefs55250f456is rubyphotographer vosplusbellesphotos wilhelmheinrichkramer
IT'S NOT EVERY DOG THAT WOULD TAKE A DUCK... (juwee1) Tags: dog pet bird animal duck duckling bruiser keesha waterfowl babyanimal pekinduck featheryfriday fowlfeatheredfriends duckspcc4u pcc4u
Big Birdy (KoriG) Tags: red pet reflection bird apple yoda parrot reflected reflect parrotlet pacificparrotlet featheryfriday abigfave colorphotoaward
Celebrity (p e t i t e C h o s e) Tags: christmas red dog pet bird animal night square crazy labrador dress surreal noel fantasy photomontage imagination surrealist elegant newyeareve manray boudi ellow petitechose martineroch flypapertextures
peace on earth (eva8*) Tags: christmas pet bird kristina parrot kristi peepers eva8 joytotheworld featheryfriday interestingness154
My pretty Girl (ineedathis) Tags: family fab pet bird parrot soe zuzu eclectus takeabow naturesfinest blueribbonwinner supershot anawesomeshot colorphotoaward impressedbeauty ultimateshot superbmasterpiece avianexcellence top20red theunforgettablepictures brillianteyejewel theperfectphotographer goldstaraward
My Dove, Beautiful Simone (Scandblue) Tags: pet white bird love peace simone dove feathers coo pictureperfect blueribbonwinner onlythebestare
Punk Parrot (_ shootpics) Tags: pet pets bird nature birds catalina nikon wildlife parrot parrots catalinamacaw nikond2x supershot featheryfriday anawesomeshot impressedbeauty aplusphoto qualitypixels
scream (pbo31) Tags: california park morning boss red pet white color bird eye alarm chicken nature colors beauty northerncalifornia yard garden landscape ilovenature hit intense kill wake natural earth farm country beak feathers favorites sanjose neighborhood scream bayarea chase rooster siliconvalley mean feed crow wakeup load scare peck southbay farmanimal shutup pecker chickencoop noice agressive santaclaracounty biebrachpark metroarea urbanarea chickneck virginastreet naturesalarm
Happy New Year!!! (KoriG) Tags: eve party pet bird hat glasses necklace beads yoda parrot newyear years 2009 happynewyear parrotlet pacificparrotlet featheryfriday hbw
Daffys Spring Delight (bluemist57) Tags: pet bird duck spring daffy featheryfriday
Still together... (sasithorn_s) Tags: pet bird nature animal lorikeet aviary sunconure naturesfinest abigfave anawesomeshot impressedbeauty superbmasterpiece diamondclassphotographer
So sweet! (KoriG) Tags: pet green bird yellow yoda pair parrot mellowyellow 2009 parrotlet naturesfinest pacificparrotlet featheryfriday featheryfriday1 avianexcellence
Technicolor Flight (_ shootpics) Tags: pet pets bird nature birds catalina nikon bravo wildlife flight parrot macaw parrots macaws catalinamacaw nikond2x blueribbonwinner featheryfriday naturesgallery abigfave aplusphoto 2008billwilson themacawshavedefinitelylearnedtocontroltheirflightsalotbetter nomorecrashingintowallsanddoors itdidnottakelongforthemtogetthehangofit harryseemedtobeflyingforfunyesterday harrywasinaflyingmoodyesterday kikithelittlecaiquegotsickofhimlandingonhercage thankfullytheothermacawsdonotseemtoflyunlessspooked theairspaceinmyofficecangetcongestedwiththreemacawsintheair
My patient subject (Nicki817) Tags: pet bird budgie parakeet interestingness448 i500 specnature
Don't Look Now (Domain Barnyard) Tags: friends pet color detail cute bird birds animals yellow wow easter duck spring colorful babies dof fuzzy sweet bokeh cluster adorable ducks ducklings 2006 canoneos20d ducky april playful quack committee gossip beaks waddle tingey grouppool quacking duckparty domainbarnyard fethers 10stars threecompany thefuz duckylife
You have to stretch your tummy... (Ollie_girl) Tags: christmas orange pet sun macro bird yellow eating parrot ollie blueberry practice conure sunconure olliewood impressedbeauty
camera shy... (daisybaxter) Tags: camera pet bird canon happy parrot shy powershot explore hut richard conure hideout sunconure happyhut featheryfriday explored pet100 sd850



page:          1        2        3 
size:     -      



50 pet bird 28 parrot 24 featheryfriday 15 birds 12 animal 11 nature abigfave 10 pets 8 yellow 7 parrots wildlife blueribbonwinner cute avianexcellence 6 sunconure parrotlet beak nikon diamondclassphotographer impressedbeauty yoda pacificparrotlet feathers portrait 5 orange nikond2x conure green naturesfinest i500 soe 4 theunforgettablepictures easter explore macaw color aplusphoto chicken supershot colorful anawesomeshot dog canon spring 3 domainbarnyard lovebird wow little pixelthis animals chick colorphotoaward reflection cat ducks parakeet white nybirds superbmasterpiece nybirdsphotos ollie 2006 theperfectphotographer red interestingness macro babies tingey adorable closeup 2009 featheryfriday1 christmas nybird duck

Pairs: 42 bird,pet 25 parrot,pet bird,parrot 23 featheryfriday,pet bird,featheryfriday 17 featheryfriday,parrot 9 bird,birds birds,pet animal,pet birds,featheryfriday abigfave,bird abigfave,pet 8 birds,parrot animal,bird 7 bird,pets pet,pets nature,pet 6 pet,sunconure avianexcellence,bird parrot,parrotlet impressedbeauty,pet bird,diamondclassphotographer diamondclassphotographer,pet nikon,pet bird,parrots bird,pacificparrotlet pacificparrotlet,yoda parrot,yoda parrotlet,pet parrots,pet bird,impressedbeauty avianexcellence,pet pacificparrotlet,pet parrotlet,yoda bird,sunconure pacificparrotlet,parrotlet parrot,pets bird,yoda bird,nikon bird,nature pet,yoda bird,parrotlet birds,pets pacificparrotlet,parrot featheryfriday,pets 5 parrot,parrots bird,orange nikond2x,pets featheryfriday,yoda pet,yellow pet,wildlife parrot,yellow nikon,nikond2x parrots,pets featheryfriday,pacificparrotlet bird,portrait nikon,parrot bird,nikond2x orange,pet featheryfriday,nikon nikon,parrots conure,parrot birds,nikon parrot,sunconure bird,yellow featheryfriday,parrotlet bird,wildlife bird,conure birds,nikond2x avianexcellence,parrot birds,parrots conure,pet blueribbonwinner,pet pet,portrait bird,blueribbonwinner nikond2x,pet impressedbeauty,parrot nikon,pets featheryfriday,parrots 4 nikond2x,wildlife bird,macaw nature,parrots orange,parrot abigfave,wildlife featheryfriday,nature pets,wildlife nikon,wildlife i500,pet featheryfriday,wildlife bird,i500 bird,dog nature,wildlife conure,featheryfriday conure,sunconure nikond2x,parrot birds,nature macaw,pet naturesfinest,pet nature,nikond2x nature,parrot bird,explore nikond2x,parrots birds,wildlife parrots,wildlife nature,nikon abigfave,parrot abigfave,nature dog,pet nature,pets abigfave,pets bird,naturesfinest featheryfriday,nikond2x explore,pet parrot,wildlife 3 impressedbeauty,pets macaw,pets featheryfriday,sunconure pet,superbmasterpiece aplusphoto,nikon colorphotoaward,pet orange,yellow featheryfriday,impressedbeauty birds,impressedbeauty cat,pet canon,pet

Users: KoriG 6 _ shootpics 5 Domain Barnyard 3 Ollie_girl nybird Edgar Thissen sansanparrots Saran Vaid Heaven`s Gate (John) adamantine ineedathis Forgotten memory moggierocket whatUthinkin Nicki817 digitalTool  bluemist57 eva8* p e t i t e C h o s e Tanya Mass pbo31 Lisa4414 juwee1 sasithorn_s Scandblue eagle1effi daisybaxter FoNgEtZ pandoraice Mats&Muffi bangkok_diary aunqtunolosepas♥ shesnuckinfuts