macaw,nature Flickr Hive Mind nature macaw bird parrot birds blue wildlife animals nikon ara Pairs: macaw,nature bird,macaw nature,parrot bird,nature macaw,parrot bird,parrot birds,macaw birds,nature blue,macaw birds,parrot Users: Angeluz888 ♫♫♫OFFLINE♫ ♫ ♫ _ shootpics iTail ~ Away Edgar Thissen John Cothron Jörg Frahm Megan Lorenz AlexandraPhotos floridapfe Aamir Yunus Michael Skelton (more)
New Flickr tool available (for Flickr users): Flickr Black Magic. See your photos on black, easily.
 Recent   Interesting   Timeline   Advanced 
Colorfull Scarlet Macaw's Feather (tropicaLiving) Tags: bali colour macro bird nature closeup catchycolors indonesia geotagged photography asia feather panoramic bec macaw blueribbonwinner supershot abigfave colorphotoaward irresistiblebeauty ysplix macroawards colourartaward artlegacy fbdg tropicaliving excapturemacro seenonflickr tropicalivingtropicallivingtropicalliving panasoniclumixdmcfz8panasoniclumixdmcfz8 jessyce geo:lon=115157318 geo:lat=8817225
I'm back! Two free Blue-Golden Macaws in Caracas! (Jrg Frahm) Tags: city plants naturaleza motion bird nature wings plantas cola balcony venezuela tail free parrot ciudad movimiento caracas landing telephoto ave alas pajaro macaw balcon lightpole libre pappagallo breathtaking papagei papagaio guacamaya birdwatcher perroquet araararauna cubism  pappagalli naturesfinest aterrizando blueribbonwinner postedeluz perroquets   papagaios supershot papageien bluegoldmacaw blueyellowmacaw passionphotography abigfave platinumphoto anawesomeshot azulyamarillo superbmasterpiece avianexcellence diamondclassphotographer flickrdiamond flickrelite dsch9 onlythebestare brillianteyejewel colourartaward excapture theperfectphotographer tricolorvenezolano goldstaraward spiritofphotography alemdagqualityonlyclub
Getting a twisted view of things (_DSC5867) (Shutterhack) Tags: travel vacation holiday hot bird nature animal d50 catchycolors asian zoo interestingness movement nikon asia view zoom action wildlife natureza natur feathers natuur natura telephoto malaysia tropical tropic macaw twisted asean equator humid mys birdpark  maleisi charakter  explored  sigmaapo70200mmf28exdghsm nikonstunninggallery kalikasan shutterhack helpsaveourearth beautifulhour
A kiss from two Golden and Blue macaws (Valentine's day - Dia de San Valentin) (Jrg Frahm) Tags: city naturaleza bird love nature palms kiss searchthebest balcony venezuela free parrot ciudad caracas ave pajaro macaw balcon palmera parrots pappagallo beso papagei valentinesday papagaio guacamaya macaws birdwatcher perroquet araararauna enamorados libres blueandyellow  pappagalli goldenglobe blueribbonwinner perroquets   papagaios papageien guacamayas bluegoldmacaw diadelosenamorados anawesomeshot azulyamarillo avianexcellence diadesanvalentin diamondclassphotographer flickrdiamond ysplix theunforgettablepictures onlythebestare overtheexcellence theperfectphotographer goldwildlife goldstaraward diadelaamistad qualitypixels thewanderlust
Cool But Not Cool (shashchatter) Tags: red bird nature wet animal cool nikon d70 dominicanrepublic parrot nikkor macaw pappagallo puntacana i4 70200mmf28gvr featheryfriday specanimal kenkoproiii2x explore06aug06
Ruperto el Loro (*atrium09) Tags: travel portrait color bird eye nature topf25 animal topv111 topv555 topv333 dof venezuela feather parrot olympus margarita pajaro macaw vignetting isla loro papagayo plumas e330 threeofakind 50v5f topvaa supershot featheryfriday specanimal atrium09 animalkingdomelite challengeyouwinner mywinners abigfave duetos shieldofexcellence potwkkc8 superaplus aplusphoto 50faves50comments500views rubenseabra
Parrots (AlexandraPhotos) Tags: usa newyork bird nature canon bravo wildlife parrot macaw animalplanet centralparkzoo naturephotography naturesfinest birdphotography blueribbonwinner wildlifephotography featheryfriday animaladdiction specanimal animalkingdomelite 400d canoneos400d alexandraphotos canon400d impressedbeauty superbmasterpiece blueheadedmacaw betterthangood coulonsmacaws primoliuscouloni
Scarlet Macaw In Honduras (Butch Osborne) Tags: travel cruise bird nature beautiful animals amazing colorful wildlife awesome parrot honduras jungle tropical creatures macaw 2008 mothernature centralamerica roaton aplusphoto avianexcellence theunforgettablepictures colourartaward unforgettablepicture flickrlovers saariysqualitypictures carribeancruise2008carribean
Guak-E (Pankcho) Tags: city blue naturaleza bird nature yellow azul fauna gold golden flying wings wire venezuela free parrot ciudad cable caracas explore amarillo alas macaw libre loro dorado pjaro guacamaya volando santamnica colourmania pankiscrazy
Technicolor Flight (_ shootpics) Tags: pet pets bird nature birds catalina nikon bravo wildlife flight parrot macaw parrots macaws catalinamacaw nikond2x blueribbonwinner featheryfriday naturesgallery abigfave aplusphoto 2008billwilson themacawshavedefinitelylearnedtocontroltheirflightsalotbetter nomorecrashingintowallsanddoors itdidnottakelongforthemtogetthehangofit harryseemedtobeflyingforfunyesterday harrywasinaflyingmoodyesterday kikithelittlecaiquegotsickofhimlandingonhercage thankfullytheothermacawsdonotseemtoflyunlessspooked theairspaceinmyofficecangetcongestedwiththreemacawsintheair
A Majestic Macaw (Angeluz888 OFFLINE  ) Tags: love nature golden globe colorful photographer pic sentosa macaw majestic soe blueribbonwinner supershot a i abigfave nikond80 platinumphoto theperfect goldstaraward angeluz888 academyofphotographyparadiso
HI! (~Dezz~) Tags: macro eye nature animals nikon bravo feathers parrot nikons1 nikoncoolpixs1 macaw interestingness50 i500 specanimal btlh abigfave
looking me from the front and me from behind (:-)carpe diem ... internet broken,sorry:() Tags: blue two bird nature golden parrot macaw soe ara naturesfinest supershot 100faves 50faves 10faves 35faves bej abigfave p1f1 anawesomeshot favemegroup6 colourartaward platinumheartaward natureoutpost rubyphotographer lesamisdupetitprince
scarlet macaw (floridapfe) Tags: color bird nature animal scarlet zoo nikon korea parakeet southkorea macaw soe everland naturesfinest d80 specanimal abigfave platinumphoto aplusphoto theunforgettablepictures
Who's afraid of red, yellow and blue? (Edgar Thissen) Tags: bird nature colors birds closeup zoo spring bravo feathers parrot macaw ara barnettnewman scarletmacaw aramacao epe mw naturesfinest dewissel edgarthissen 28398 specanimal diamondclassphotographer flickrdiamond whosafraidofredyellowandblue
Summer Colors (Megan Lorenz) Tags: blue green bird nature outdoors colorful looking bright wildlife watching parrot staring macaw papagei avian ara wildanimals perroquet faved naturesfinest militarymacaw blurredbackground abigfave platinumphoto colorphotoaward 22faves theunforgettablepictures goldstaraward vosplusbellesphotos
Hyacinth Macaw (iTail ~ Away) Tags: blue wild bird nature gold parrot jungle macaw foul hyacinthmacaw goldenglobe blueribbonwinner flickrsbest bej golddragon platinumphoto brillianteyejewel goldstaraward
too close amigo [explore FP ... TY!] (Wils 888 [busy]) Tags: blue portrait bird nature yellow closeup lens nikon parrot micro macaw f28 105mm d90 nikond90
Here's looking at you! (Angeluz888 OFFLINE  ) Tags: show blue love me nature yellow golden globe photographer looking you quality pic your sentosa macaw pixels soe heres outstanding blueribbonwinner i abigfave nikond80 platinumphoto anawesomeshot superbmasterpiece pinoykodakero ysplix eliteimages platinumheartaward theperfect goldstaraward angeluz888 natureselegantshots
Oz Flight 8048 (_ shootpics) Tags: pet pets bird nature birds nikon flight parrot macaw parrots macaws blueandgoldmacaw nikond2x featheryfriday avianexcellence 2009billwilson sorryijustdontgettiredofmacawflightshots onemoreofozzycominginlow sheisgettingtobequitetheflyer butstillwillrunyouover
CRISTO REDENTOR (Christ the Redeemer) - The wings of faith are red (|eliezer|) Tags: world life travel blue red brazil urban sculpture bird monument latinamerica southamerica nature colors animals yellow statue stone brasil riodejaneiro wow cores landscape photography death freedom fantastic cityscape cidademaravilhosa christ heart time god folk earth saudade glory magic faith religion jesus feather culture pssaro aves totem cristoredentor corcovado talent latin planet brave imagination forever feeling olympics cristo spiritual macaw eternity epic timeless carioca sevenwonders arara jesuschrist openwings imortal canind imortality jogospanamericanos hollyness rio2016
Scarlet Macaw's Romance at the nest (City Parrots) Tags: pets nature birds animals wildlife thenetherlands parrot macaw parrots ara scarletmacaw aramacao naturephotography wildparrots animalkingdomelite cityparrots
A arara-azul-grande (Anodorhynchus hyacinthinus) (ThiagoBarreto) Tags: blue wild naturaleza verde green nature colors animals yellow azul fauna cores amazon minolta wildlife sony natureza colores 300mm amarelo beercan bichos macaw animais extinction wwf preservation a100 arara wildanimals amazonia extino vidaselvagem araraazul preservao bej animaissilvestres sonyalpha alpha100 platinumphoto beercam bigbeercan theperfectphotographer bigbeercam sillvestre
Hello There! (John Cothron) Tags: blue bird nature birds canon nashville tennessee parrot 5d endangered macaw nashvillezoo hyacinthmacaw anodorhynchushyacinthinus 6744 grassmerezoo johncothron
Green-winged macaw, 04 (Hobby-Photograph) Tags: holland bird nature netherlands animal fauna scarlet tiere nederland parrot greatshot macaw amateur papagei ara tier vogel niederlande birdwatcher dierenpark naturesfinest greenwingedmacaw blueribbonwinner hobbyphotograph platinumphoto colorphotoaward zooemmen diamondclassphotographer flickrdiamond flickrelite overtheexcellence betterthangood theperfectphotographer thebestofday gnneniyisi colourvisions hellroter
Best Buddies (Angeluz888 OFFLINE  ) Tags: show me nature birds colorful buddies quality best your sentosa macaw pixels soe supershot nikond80 superbmasterpiece ysplix goldstaraward angeluz888
Macaw (Stanegg) Tags: world africa wood blue original wild portrait orange pets colour green nature beauty animal yellow photoshop fly flying wings branch beak explore fujifilm macaw parrots mascotas loro goldstaraward petsparrotshorsehorsesnatureportraitsgardengardensallotmentfillyponysummerwinterspringsunportraitanimalbrownrace
Is this close enough? (Marina C.Ribeiro- I'm Back!!!!!) Tags: nature birds animals wildlife parrot aves macaw animais papagaio arara naturesfinest avisittothezoo impressedbeauty diamondclassphotographer flickrdiamond incrediblenature theunforgettablepictures goldstaraward itsazoooutthere marinacribeiro
Scarlet Macaw (Aamir Yunus) Tags: wild nature birds animals zoo sandiego parrot lovelovelove macau macaw soe naturesfinest blueribbonwinner 25faves abigfave aplusphoto diamondclassphotographer flickrdiamond superhearts theunforgettablepictures colourartaward platinumheartaward theperfectphotographer thegardenofzen
~ ARA says Hello  ;-) (together8) Tags: nature animal zoo austria parrot krnten carinthia macaw soe ara blueandyellowmacaw overlayed nikond40 gelbbrustara together8 imagesforthelittleprince worldsartgallery oracope vogelparkturnersee
moire (spacedogleica) Tags: blue bird nature leicester feathers parrot tropical moire macaw soe catchycolour birdland desford colorphotoaward flickrdiamond
Just a little to the left please.... (John Cothron) Tags: blue bird nature birds canon nashville tennessee parrot 5d endangered macaw nashvillezoo hyacinthmacaw anodorhynchushyacinthinus 6745 grassmerezoo goldstaraward johncothron
Blue and Yellow Macaw (Chi Liu) Tags: bird nature canon searchthebest macaw araararauna naturesfinest blueandyellowmacaw featheryfriday chiliu
Blue Parrot with a Wise Smile (BBMaui) Tags: blue pet pets cute bird nature beautiful birds animals topv111 hawaii topv333 wildlife parrot exotic kauai tropical macaw animalkingdomelite impressedbeauty aplusphoto
Blue and Gold Macaw 2 (Martin-DRZ) Tags: blue bird nature animals gold zoo parrot macaw twycross animalkingdomelite abigfave
Intense (Megan Lorenz) Tags: blue bird nature yellow closeup gold colorful looking bright bokeh watching parrot 1001nights staring macaw soe avian blueandgoldmacaw naturesfinest blueandyellowmacaw blueribbonwinner blurredbackground supershot abigfave shieldofexcellence platinumphoto theunforgettablepictures goldstaraward thebestofday qualitypixels oltusfotos
Nut Lover (_ shootpics) Tags: pet pets bird nature birds nikon wildlife parrot macaw parrots macaws nikond2x scarlettmacaw aplusphoto 2008billwilson forthechristmasseasoniguessthisismyownversionofthenutcracker
Rainbow (120SQN) Tags: colour southamerica nature birds scarlet bristol zoo flying wildlife parrot macaw ara macao bristolzoo scarletmacaw aramacao rainforests blueribbonwinner ar1 avianexcellence almostanything itsazoooutthere
"Hi, I really like you!" (Michael Skelton) Tags: usa detail green bird eye southamerica nature birds closeup colorful looking florida wildlife watching beak feathers jungle sarasota captive staring macaw exoticbird rescued captivity plumage sarasotajunglegardens abigfave vosplusbellesphotos
Fly Ekko Fly!! (sasithorn_s) Tags: bird nature parrot macaw blueandgoldmacaw freeflying naturesfinest abigfave myfavouritebird ultimateshot avianexcellence diamondclassphotographer flickrdiamond ilovemybirds
Do I LOOK Like I Want a Cracker? (TheEclecticArtisan) Tags: atlanta bird nature canon colorful natural bright vivid parrot macaw straightfromcamera hollysmith flickrsbest specanimal canonpowershots3is mywinners colorphotoaward impressedbeauty diamondclassphotographer flickrdiamond excellentphotographerawards theeclecticartisan excapture akassignmentvibrancy eclecticartisanstudios eclecticeyestudios
Hello:) (Angeluz888 OFFLINE  ) Tags: hello bird nature photographer macaw soe golddragon nikond80 anawesomeshot aplusphoto angelphoto theunforgettablepictures theperfect goldstaraward angeluz888 rubyphotographer showmeyourqualitypixels
Macaw (Angeluz888 OFFLINE  ) Tags: park nature photographer macaw soe blueribbonwinner golddragon platinumphoto anawesomeshot diamondclassphotographer flickrdiamond sonydsct50 theperfect betterthangood angeluz888 colorfulmacaw
Macaw 3 (MEaves) Tags: color bird nature closeup pentax beak macaw k10 naturesfinest grantsfarm pentaxk10d anawesomeshot justpentax
Military Macaw (Edgar Thissen) Tags: bird 20d nature birds canon zoo bravo belgium parrot explore macaw ara planckendael naturesfinest militarymacaw aramilitaris pgphotography edgarthissen 25867 flickrsbest specanimal avianexcellence bratanesque
Things are looking up! (_ shootpics) Tags: pet pets bird nature birds nikon wildlife parrot macaw parrots macaws blueandgoldmacaw nikond2x featheryfriday abigfave impressedbeauty aplusphoto lmaoanimalphotoaward goldstaraward
Macaw (Domain Barnyard) Tags: pet bird nature animal interesting colorful wildlife beak feathers parrot 2006 canoneos20d exotic tropical april macaw ara tingey psittacidae largebird domainbarnyard i500 specnature kukadoo april102006 ranked265 psittacinebirds specanimals kakadoochoice
Scarlet Macaw! (iTail ~ Away) Tags: red bird nature outdoors feathers tropical macaw foul parot tropicalbird inspiredbylove totalphoto mywinners abigfave anawesomeshot citrit theunforgettablepictures goldwildlife goldstaraward
another bird shot:) (Angeluz888 OFFLINE  ) Tags: blue nature yellow photographer bokeh macaw soe birdpark hbw golddragon nikond80 anawesomeshot theperfect angeluz888 qualitypixels llovemypics angeluzphoto anotherbirdshot
Pretty Boy (Dizzee Dayzee) Tags: nature birds florida parrot macaw staugustine blueandgoldmacaw naturesfinest goldenmix avianexcellence diamondclassphotographer flickrdiamond wonderfulworldmix



page:          1        2        3 
size:     -      



50 nature macaw 36 bird 34 parrot 17 abigfave 16 birds blue 15 naturesfinest 14 goldstaraward wildlife 13 blueribbonwinner 12 soe 11 flickrdiamond 10 platinumphoto diamondclassphotographer 9 theunforgettablepictures animals nikon aplusphoto anawesomeshot ara 8 zoo animal yellow specanimal colorful avianexcellence 7 pets parrots supershot featheryfriday feathers 6 pet angeluz888 closeup tropical canon 5 nikond80 bravo macaws photographer colorphotoaward colourartaward blueandgoldmacaw animalkingdomelite theperfectphotographer impressedbeauty theperfect 4 wild beak naturaleza golden nikond2x green superbmasterpiece golddragon venezuela papagei gold looking travel ysplix 3 perroquet fauna birdwatcher watching sentosa explore eye jungle bej caracas pappagallo color staring blueandyellowmacaw loro bright city free ciudad flying araararauna wings flickrsbest feather guacamaya red colors southamerica love papagaio hyacinthmacaw arara scarlet pajaro qualitypixels scarletmacaw aramacao mywinners platinumheartaward portrait betterthangood colour

Pairs: 43 macaw,nature 31 bird,macaw nature,parrot bird,nature 27 macaw,parrot 24 bird,parrot 16 birds,macaw birds,nature 15 abigfave,nature 14 blue,macaw birds,parrot blue,nature nature,naturesfinest 12 nature,wildlife nature,soe 11 blue,parrot macaw,wildlife macaw,naturesfinest blueribbonwinner,nature goldstaraward,nature bird,blue abigfave,bird bird,naturesfinest parrot,wildlife 10 macaw,soe bird,birds 9 ara,nature naturesfinest,parrot bird,wildlife abigfave,macaw flickrdiamond,nature 8 nature,theunforgettablepictures colorful,macaw flickrdiamond,macaw aplusphoto,nature goldstaraward,macaw macaw,nikon ara,parrot nature,platinumphoto colorful,nature birds,wildlife nature,nikon diamondclassphotographer,nature 7 macaw,pets animals,parrot aplusphoto,bird nature,specanimal nature,zoo nikon,parrot diamondclassphotographer,macaw macaw,specanimal animals,macaw bird,goldstaraward macaw,zoo abigfave,parrot animals,nature nature,pets bird,nikon anawesomeshot,nature flickrdiamond,parrot 6 blue,yellow parrot,pet bird,specanimal featheryfriday,nature avianexcellence,nature parrot,specanimal parrots,pets angeluz888,nature canon,macaw bird,colorful macaw,pet bird,theunforgettablepictures closeup,macaw parrot,zoo closeup,nature canon,nature anawesomeshot,macaw diamondclassphotographer,parrot ara,macaw blue,goldstaraward bird,pet blueribbonwinner,macaw bird,closeup avianexcellence,parrot parrot,pets bird,canon ara,bird bird,blueribbonwinner nature,pet birds,pets aplusphoto,macaw bird,featheryfriday feathers,nature 5 bird,flickrdiamond bird,tropical nature,parrots pet,wildlife bird,colorphotoaward nature,nikond80 pets,wildlife nature,photographer nature,theperfect feathers,macaw goldstaraward,parrot bird,feathers bird,soe avianexcellence,macaw colorful,parrot aplusphoto,wildlife bird,pets colorphotoaward,nature nature,tropical impressedbeauty,macaw birds,pet abigfave,blue birds,naturesfinest blueandgoldmacaw,nature aplusphoto,birds macaw,theunforgettablepictures canon,parrot animal,nature blue,soe pet,pets impressedbeauty,nature bravo,parrot birds,parrots featheryfriday,macaw bird,platinumphoto bravo,macaw bravo,nature nature,supershot aplusphoto,parrot impressedbeauty,parrot angeluz888,soe angeluz888,macaw nature,yellow 4 parrot,parrots macaws,pets avianexcellence,bird animal,macaw abigfave,naturesfinest aplusphoto,nikon bird,diamondclassphotographer nikond2x,pets soe,theperfect birds,diamondclassphotographer ara,zoo abigfave,birds macaw,yellow nikon,nikond2x colorful,goldstaraward nikon,pet bird,parrots blue,platinumphoto diamondclassphotographer,naturesfinest ara,birds bird,nikond2x macaws,nikon bird,bravo macaws,pet anawesomeshot,bird abigfave,nikon abigfave,soe angeluz888,photographer

Users: Angeluz888 ♫♫♫OFFLINE♫ ♫ ♫ 6 _ shootpics 4 iTail ~ Away Edgar Thissen John Cothron Jörg Frahm Megan Lorenz AlexandraPhotos floridapfe Aamir Yunus Michael Skelton Domain Barnyard *atrium09 Shutterhack Martin-DRZ shashchatter Marina C.Ribeiro- I'm Back!!!!! Wils 888 [busy] together8 120SQN Stanegg Hobby-Photograph sasithorn_s Pankcho spacedogleica MEaves City Parrots :-)carpe diem ... internet broken,sorry:( BBMaui TheEclecticArtisan ThiagoBarreto Chi Liu tropicaLiving Butch Osborne |eliezer|® Dizzee Dayzee ~Dezz~