muscles,selfportrait Flickr Hive Mind selfportrait muscles portrait male man self hunk body me muscular Pairs: muscles,selfportrait muscles,portrait portrait,selfportrait male,selfportrait man,selfportrait man,muscles male,muscles self,selfportrait portrait,self male,man Users: joe469 dr_mike © justinbess © mystica_l0v3 andrea francesco Capt. Mouffette moraima_D Jen ! Miz J. Stoker Studios Abdullah AL-Naser (more)
New Flickr tool available (for Flickr users): Flickr Black Magic. See your photos on black, easily. Now with any color backround!
 Recent   Interesting   Timeline   Advanced 
Welcome to Flickr Hive Mind, almost certainly the best search engine for photography on the web. If you are a Flickr user and Log into Flickr you will be able to see your private photos, as well as larger thumbnails. Hivemind: http://fiveprime.org/hivemind/Tags/muscles,selfportrait Hits: 473 Pages: 10 Flickr Hive Mind is a data mining tool for the Flickr photography database. Where do these thumbnails come from? How are the photos licensed?
The Mirror (andrea francesco) Tags: camera wedding boy wallpaper selfportrait man me strange muscles mirror photo room 100v10f screen anatomy oldphoto autoritratto specchio mdsw scritturedistrada kay84
teenager no more (dr_mike) Tags: two portrait selfportrait male muscles self autoportrait highcontrast michele autoritratto due dirtylook drmike birthdaycandle muscleboy
Humble Progress (Abdullah AL-Naser) Tags: lighting camera light portrait selfportrait west muscles self mirror virginia student university shot gym morgantown relfection selfshot
Origin of Sin (andrea francesco) Tags: selfportrait me muscles skin mark shoulder spalla voglia originofsin loriginedelpeccato mgblack mgshadow mground
Sweden rocks your socks off! (mystica_l0v3) Tags: portrait woman selfportrait ikea me girl muscles self nikon sweden bodybuilding presentation bodybuilder nikkor gym d80 18135mm sb900
12/365 "isometrics" {EXPLORED} (Stoker Studios) Tags: selfportrait muscles sp 365 workout gym 12365 isometrics stokerstudios jessicastoker sweatandstuff
Ennui (joe469) Tags: light shadow shirtless portrait selfportrait man hot male guy muscles self italian masculine muscle muscular bare chest narcissist handsome hunk uomo depechemode 365days 1mill
Tough Guy (joe469) Tags: selfportrait man cute male guy face muscles sunglasses tattoo beard cool italian masculine muscular handsome hunk tribal superman dude uomo rayban stubble 365days 365alumni
Shot (Victoriano) Tags: selfportrait motion art colors muscles photoshop wow landscape lights jump jumping shot artistic sunny sequence victoriano 16yearsold flogr
the puppies are back (nettsu) Tags: gay hairy selfportrait male me muscles chest ofme 2006 cheesecake fit gayman thepuppiespoppedouttosayhello
stunning pose (Tijs van Bragt) Tags: me myself ich ik moi self selfportrait portrait chair stoel cafe hot cute hunk stud cutie eyes eye glasses youngman young boy teenager adolecent photographer asperger flickr photo beautiful pose neat stunning muscle muscles men beauty summer spring garden wall white black afternoon groede holland netherlands zeeland pure real
ego (dr_mike) Tags: selfportrait me muscles self myself pain poetry photos body postit guitars piercing hate lust muscleman bliss empathy scalpel regrets compulsion bwselfportrait guapetones piercedman
polaroid (dr_mike) Tags: bw music selfportrait muscles rock sex polaroid guitar fantasy autoritratto seventies fenderstratocaster rockandroll badboy chitarra
the rotten heart of our history (dr_mike) Tags: birthday family selfportrait male muscles naked bathroom heart famiglia bathtub autoritratto cuore cornice buoncompleanno drmike vascadabagno cosaresta therottenheartofourhistory ilcuoreputrefattodellanostrastoria
67/365...i ain't afraid of no RATatouille, as long as hello kitty's with me. [eXpLorEd] (papErdoLL) Tags: selfportrait me muscles hat yellow tattoo myself beard sony fake chesthair cybershot mustache macho paperdoll 67 pointshoot ratatouille hellokity malfoy 365days selfportraitchallenge muskels teiluj dscw110 fspasgsp iaintafraid
portrait of strength (day 135) (fickle woman screaming) Tags: red selfportrait muscles yoga boots fit campers 365days
Sadness (Jardel A) Tags: blue boy brazil portrait selfportrait man color colour male guy art me muscles wall self hair myself wooden back soft sad view im body widescreen manipulation jeans crop depression be brazilian cropped depressed iam bluejeans mad hue selfpotrait bluewall blueroom bluehue introspective myback woodenwall melancolic bluebed iintrospectiveview woodenroom
Making A Sandwich (joe469) Tags: shirtless portrait selfportrait man hot cute male guy cooking kitchen muscles self italian body masculine muscle muscular bare chest smooth narcissist handsome hunk sandwich dude uomo tuna stubble 365days
Crouching Tiger? (Gold N Girl) Tags: selfportrait feet muscles hair blackwhite back long arms legs bodylanguage velvet blonde shoulder timer gemini highlighted haltertop wedgesandals bwwoman sunlightismyonlylightsource photographyismyfreedomofexpression nophotoshopherewhatitakeiswhatyousee iamalittlegirlinsideawomansbody
Fluoresce (Harvey Schiller - chateauglenunga) Tags: blue orange selfportrait man colour male muscles yellow back glow arms bright skin fingers violet harvey figure intertwined selfe chateauglenunga
Like it or Not - no one better to rely on ( justinbess ) Tags: justin light boy shadow portrait selfportrait man male love me beautiful muscles composite manipulated dark myself poster model eyes artistic body muscular madonna creative bodylanguage portraiture duality genius dudes selfportraiture adonis bess bady pheromones justinbess justinbess creativephotographers humanbodygallery2incolors
Dancing After Dark ( justinbess ) Tags: show justin bw selfportrait man black male art beautiful beauty muscles dark nude poster dance muscular stage performance bodylanguage hunk after bess justinbess justinbess humanbodygallerybw
Should I Or Shouldn't I? (joe469) Tags: shirtless selfportrait man male muscles bathroom italian masculine bare chest handsome hunk towel uomo 365days
Time To Give (joe469) Tags: christmas shirtless portrait selfportrait man tree cute male guy beautiful smile face muscles tattoo self pose ego hair beard lights star italian body masculine muscle muscular bare teeth chest narcissist handsome hunk dude uomo gifts presents barefoot buff barefeet bluejeans toned flattop fit stubble adoreable hnf
day 53: a set of movements (kaylakern) Tags: selfportrait muscles movement exercise run sp workout 365days
Hee! (carrier) Tags: selfportrait me muscles fight redhead fist giggle punch obliginglysilly
Maybe it's not too late to learn how to fly, not if they set the wings right ... there. (ej (umop ap!sdn)) Tags: family portrait bw selfportrait man me muscles closeup back nikon experimental father chiaroscuro d80 bringinsexyback phlow:status=back flickr:user=ejumopapsdn
pearl necklace ( justinbess ) Tags: justin boy summer portrait sun white selfportrait man hot male art me boys muscles self model artistic body muscular bodylanguage hunk portraiture selfportraiture adonis bess justinbess justinbess
322/365 - gray's anatomy: fig. 1 (B Rosen) Tags: cameraphone portrait selfportrait me muscles self neck nikon fig tendon medical human diagram anatomy 365 textbook iphone grays fig1 d60 365days nikond60 365project mygirlfriendmakesmewatchgreysanatomy callmewhatyouwillbutprettymucheveryguywithagirlfriendhaswatchedthisshow
238/365: Lazy Friday (Capt. Mouffette) Tags: food sunlight selfportrait brick girl face muscles wardroberemix project book ross afternoon shadows eating nintendo steps tattoos sp porch tanktop fruitsalad finalfantasy 2008 selfie crotchshot wetseal forever21 orsonscottcard whatiworetoday acidwashjeans myeverydaylife 365days speakerforthedead strawberriescantaloupemangoandredapple
The Perfect Push-Up (joe469) Tags: shirtless portrait selfportrait man cute male smile muscles self ego italian exercise body masculine muscle muscular bare handsome hunk dude uomo barefoot barefeet pushups hnf 365days
What Goes Up... (joe469) Tags: christmas shirtless portrait selfportrait man cute male guy beautiful muscles tattoo self ego lights italian legs masculine muscle muscular smooth narcissist handsome hunk dude uomo barefoot barefeet toned fit hnf 365days
People need hard times and oppression to develop psychic muscles. (mystica_l0v3) Tags: light portrait woman selfportrait me girl muscles silhouette female self pose studio back nikon arms sweden body flash bodybuilding shoulders weightlifting bodybuilder nikkor fitness lumbar strobes d80 18135mm
In With The New (joe469) Tags: nyc shirtless portrait selfportrait man hot male guy muscles tattoo self work ego tile beard bathroom shower back cool italian skin body masculine muscle muscular manhattan bare chest curtain smooth tan narcissist handsome hunk tribal dude uomo domestic tub sweat buff dimples shoulders toned fit stubble backdimples 365days
New Year's Eve (joe469) Tags: christmas shirtless portrait selfportrait man tree cute male guy smile face muscles self ego lights italian fireplace body masculine muscle muscular bare champagne chest narcissist handsome hunk dude uomo barefoot newyearseve buff barefeet toned fit veuveclicquot adoreable hnf
Chicken Legs (joe469) Tags: shirtless portrait selfportrait man hot cute male guy face pecs muscles self pose ego beard skinny italian legs body masculine muscle muscular bare chest narcissist handsome hunk dude uomo barefoot buff barefeet toned fit stubble 365days
Finest Hour (joe469) Tags: shirtless portrait selfportrait man hot male guy coffee muscles television tattoo self ego back tv italian skin body masculine muscle muscular bare narcissist handsome hunk dude uomo starbucks barefoot barefeet toned 90210 fit 365days
Super Bowl Sunday (joe469) Tags: shirtless portrait selfportrait man cute male guy face muscles tattoo self ego beard back cool italian skin body masculine muscle muscular bare chest sunday narcissist handsome hunk dude uomo clones buff superbowl clone toned fit stubble superbowlsunday 365days
Fresh Squeezed (joe469) Tags: shirtless portrait selfportrait man cute male guy kitchen smile face muscles self ego beard italian skin body masculine muscle muscular bare chest narcissist handsome hunk dude uomo buff margarita lime toned fit stubble squeezing 365days
Addiction (joe469) Tags: life nyc shirtless portrait white selfportrait man male guy kitchen muscles tattoo self ego back cool italian skin drink body masculine muscle muscular manhattan bare smooth tan narcissist hunk tribal dude uomo dietcoke barefoot buff dimples shorts refrigerator toned mundane fit calves backdimples 365days
Day 157: Jumping through the sprinklers (~Kristin Taking Flight~) Tags: woman selfportrait me water muscles jump legs hose sp sprinkler kinda calves selfie juneisforjumping
...and now, shoot. (dr_mike) Tags: selfportrait male muscles naked gun skin piercing target autoritratto viewfinder dirtylook drmike bersaglio mirino getyourgun abigfave eoraspara andnowshoot
Into Your Arms (joe469) Tags: shirtless selfportrait man cute male guy muscles italian skin body masculine bare chest handsome hunk dude uomo thecure thelemonheads 365days charlottesometimes 365alumni intoyourarms
Me and myself: What you see is what you get (Self Deception) (jcoterhals) Tags: portrait selfportrait man reflection muscles manipulated canon skinny mirror soft absurd muscular photoshopped hard montage strong bodybuilder wishfulthinking chubby canoneos350d meandmyself sixpack weak wysiwyg trained bounceflash speedlite sigma185028 untrained selfdeception speedlite550ex misrepresentation pseudotwins unmuscular
hanging myself(9/365) (Genergrohl) Tags: light boy portrait selfportrait muscles vintage bag gold shadows ghost plastic suffocated genergrohl
What Lies Beneath 115/365 (Jen !) Tags: portrait blackandwhite woman selfportrait monochrome muscles skeleton skull drawing bones gesture selfie 365days
Hulk (darkpatator) Tags: usa selfportrait paris france building green me muscles monster trash america photomanipulation self mouth dark comics myself french comic force power body flag teeth awesome hard bad super anger american gore scream ugly hero angry expressive strong strength heroes hulk marvel fitness incredible loud violent invincible heroe darkpatator ithinkthisisart invunerable anarchisticsouls
Day 203 (lisabelle0705) Tags: selfportrait muscles husband showoff 365days istilllovehim
blue silhouette (moraima_D) Tags: blue selfportrait black muscles silhouette azul canon catchycolors superhero
77.0/365 - Doubtful Morning (Miz J.) Tags: portrait bw white selfportrait black me face muscles self dark hair myself blackwhite back eyes nikon noir shadows darkness emotion noiretblanc body sigma nb question forms 365 limbs doubt emotional shape doubtful blanc mouvement sensitivity 30mm project365 365days thirtysomethingwomen threesixtyfive 365ish le365

page:          1        2        3 
size:     -      



50 selfportrait muscles 26 portrait 24 male 23 man self 21 365days 18 hunk body 17 me muscular 15 italian uomo masculine 14 guy handsome shirtless 13 bare dude muscle 11 fit chest cute narcissist 10 ego back 9 skin toned 8 tattoo face 7 barefoot beard buff hot stubble myself 6 barefeet boy 5 light nikon beautiful autoritratto 4 sp smooth lights dark cool hnf art white pose woman legs black smile bw hair bodylanguage 3 mirror artistic eyes justin gym arms selfie kitchen girl drmike shadows d80 ©justinbess bess bathroom christmas justinbess tribal bodybuilder 365 blue

Pairs: 40 muscles,selfportrait 18 muscles,portrait portrait,selfportrait 17 male,selfportrait 365days,selfportrait 16 man,selfportrait man,muscles 15 male,muscles 14 self,selfportrait portrait,self 13 male,man 12 hunk,man 365days,muscles me,selfportrait me,muscles hunk,selfportrait 11 shirtless,uomo man,muscular masculine,shirtless man,shirtless selfportrait,shirtless handsome,shirtless man,portrait male,shirtless muscular,selfportrait hunk,shirtless muscles,shirtless italian,shirtless 10 handsome,selfportrait handsome,man hunk,male male,portrait muscular,portrait selfportrait,uomo 365days,man italian,selfportrait 365days,shirtless man,masculine 365days,portrait bare,shirtless italian,man man,uomo masculine,selfportrait 9 dude,shirtless muscular,shirtless portrait,shirtless body,selfportrait muscle,shirtless self,shirtless muscles,self guy,shirtless hunk,portrait 8 365days,male dude,selfportrait male,masculine italian,male handsome,male bare,selfportrait portrait,uomo guy,man italian,portrait male,muscular masculine,portrait man,self guy,selfportrait handsome,portrait narcissist,shirtless muscle,portrait cute,shirtless male,uomo chest,shirtless dude,man body,portrait body,shirtless bare,man 7 narcissist,portrait cute,selfportrait dude,portrait male,self cute,man bare,portrait chest,selfportrait ego,shirtless muscle,selfportrait body,man man,muscle guy,portrait hunk,muscles 6 cute,muscles dude,male cute,masculine bare,male muscles,muscular fit,shirtless cute,italian shirtless,toned muscles,uomo guy,male cute,portrait cute,uomo fit,selfportrait cute,dude 365days,cute selfportrait,skin chest,man italian,muscles cute,male man,narcissist

Users: joe469 15 dr_mike 5 © justinbess © 3 mystica_l0v3 andrea francesco Capt. Mouffette moraima_D Jen ! Miz J. Stoker Studios Abdullah AL-Naser fickle woman screaming jcoterhals darkpatator Gold N Girl Victoriano nettsu lisabelle0705 ©papErdoLL kaylakern carrier ~Kristin Taking Flight~ Genergrohl ej (umop ap!sdn) B Rosen Jardel A Harvey Schiller - chateauglenunga Tijs van Bragt