parrot,pet Flickr Hive Mind parrot pet bird featheryfriday birds pets parrotlet parrots pacificparrotlet nature Pairs: parrot,pet bird,parrot bird,pet featheryfriday,pet bird,featheryfriday featheryfriday,parrot birds,pet birds,parrot bird,birds pet,pets Users: KoriG _ shootpics Ollie_girl sansanparrots nybird ezys vitamar *amy&kimball eftimov-schenk-schwartz Saran Vaid Fliker_2000 (more)
New Flickr tool available (for Flickr users): Flickr Black Magic. See your photos on black, easily.
 Recent   Interesting   Timeline   Advanced 
Goffin Cockatoo at 1 month old (nybird) Tags: pet white cute bird nature birds animal interestingness mosaic interestingness1 feathers adorable parrot aves avi crest exotic cockatoo babybird exoticbird parrots avian petbird avis cmc goffin interestingness2 babybirds amyfav goffincockatoo interestingness4 30000views exoticbirds supershot featheryfriday adorablog interestingnesstop10 awwwthatsthecutestphotoiveseenallweek explore19december05 i500 cacatuagoffini commentonmycuteness nybird stuckincustomsbrilliantcabal nybirds pixelthis nybirdsphotos gettyimagespick
Sunshine the lovebird (adamantine) Tags: orange pet cute bird yellow pretty lovely1 beak parrot cage caged tropical lovebird pappagallo papagei loro papagaio perroquet papegaai 123faves petercristofono
Happy Feathery Friday Easter Chicks! (nybird) Tags: pet bird easter babies basket parrot chick chicks cockatiel parrots easterbasket tt1 kodakcx7430 featheryfriday nybird nybirds themeoftheweekcollections pixelthis nybirdsphotos
What cha doin' ? (Ollie_girl) Tags: orange pet bird yellow parrot ollie sunconure i500
"Amigo" - Amazona amazonica (eagle1effi) Tags: pet macro bird birds animal closeup amigo amazon colorful framed wildlife parrot icon crop vgel soe haustier picnik sx1 vogel amazona damncool amazone otw amazonica 30faves canonmacro 10faves views100 views800 views200 20faves views600 views400 views300 views1100 views1000 views1500 views2000 100comments orangewinged 25faves platinumphoto citrit theunforgettablepictures servoaf naturemasterclass 3wordcomments qualitypixels 100commentgroup canonpowershotsx1is sx1best fixedstand sacrosankt sx1isbest sx1fave canonsx1referenceshot canonpowershotsx1isreferenceshot
My green hottie (Tanya Mass) Tags: pet green bird parrot budgerigar parakeet exquisite kiwi blueribbonwinner top20birdshots abigfave shellparakeet avianexcellence excellenceinavianphotography diamondclassphotographer flickrdiamond theperfectphotographer top20vivid multimegashot tanyamass
Happy Thanksgiving! (KoriG) Tags: thanksgiving pet bird dinner turkey yoda searchthebest parrot diningroom yaddle parrotlet pacificparrotlet featheryfriday isitcannibalisticforaparrotlettopretendtoeataturkey
HAPPY FEATHERY FRIDAY!  Are ya ready?  Let's Go! (Ollie_girl) Tags: pet sun bird ilovenature interesting parrot ollie conure sunconure featheryfriday i500
Happy Birthday Daddy (whatUthinkin) Tags: portrait dog pet bird beautiful kids puppy bristol children interestingness mort pug indiana parrot explore bubba elkhart bestfriends southbend goshen mishawaka naturesfinest bluecrownedconure explored happybirthdaydaddy everythingindiana pugable
Technicolor Flight (_ shootpics) Tags: pet pets bird nature birds catalina nikon bravo wildlife flight parrot macaw parrots macaws catalinamacaw nikond2x blueribbonwinner featheryfriday naturesgallery abigfave aplusphoto 2008billwilson themacawshavedefinitelylearnedtocontroltheirflightsalotbetter nomorecrashingintowallsanddoors itdidnottakelongforthemtogetthehangofit harryseemedtobeflyingforfunyesterday harrywasinaflyingmoodyesterday kikithelittlecaiquegotsickofhimlandingonhercage thankfullytheothermacawsdonotseemtoflyunlessspooked theairspaceinmyofficecangetcongestedwiththreemacawsintheair
PARROT JUNGLE (Fliker_2000) Tags: life city trip travel family blue light vacation en pet cute me colors beautiful beauty fun bravo funny flickr day tour parrot famly que este vacations con famiy cotorra etiqueta d300 blueribbonwinner flickr365 colorphotoaward theunforgettablepictures theperfectphotographer goldstaraward
we're off to see the wizard (sansanparrots) Tags: friends dog pet bird pembroke interestingness corgi parrot explore macaw welshcorgi greenwingmacaw kaley featheryfriday
The latest addition to my menagerie-solo (eftimov-schenk-schwartz) Tags: pet home colours parrot silvermedal budgies itsaboy 50faves abigfave omot diamondclassphotographer flickrdiamond theunforgettablepictures theperfectphotographer goldstaraward rubyphotographer
Personata (Edgar Thissen) Tags: portrait pet bird birds closeup parrot lovebird tika agapornis mw personata edgarthissen featheryfriday outstandingshots 36811 specanimal avianexcellence
good nite kiss to you chiquita (sansanparrots) Tags: orange pet bird birds parrot conure sunconure featheryfriday maroonbelly
Puffy Parrot 4429 (_ shootpics) Tags: pet pets bird nature birds nikon wildlife parrot parrots caique nikond2x featheryfriday abigfave impressedbeauty aplusphoto
Our dear Maksinka. (vitamar) Tags: friends pet pets love birds fauna fun grey friend friendship parrot africangreyparrot africangrey tropical tropicalbirds blueribbonwinner macromarvels maksinka llovemypic
The Happy Couple (KoriG) Tags: pet bird yellow engagement couple yoda little pair parrot pearls ring diamond mellowyellow jewlery bling 2009 parrotlet pacificparrotlet featheryfriday featheryfriday1 americanyellow
Oz Flight 8048 (_ shootpics) Tags: pet pets bird nature birds nikon flight parrot macaw parrots macaws blueandgoldmacaw nikond2x featheryfriday avianexcellence 2009billwilson sorryijustdontgettiredofmacawflightshots onemoreofozzycominginlow sheisgettingtobequitetheflyer butstillwillrunyouover
Too Much Hair Gel? (_ shootpics) Tags: pet pets bird birds nikon wildlife parrot macaw parrots blueandgoldmacaw nikond2x featheryfriday abigfave impressedbeauty diamondclassphotographer canneverhavetoomanypets twodogsacatandacaiquewerenotenough thelatestadoption parrotsaregreatforansweringtelemarketingcalls youcanevenprogramthemtoarguewithyourkidsforyou timetobuildanarkanybodyhavetwogiraffes
Exploring the Enemy (ezys) Tags: friends dog pet sun playing yellow lab labrador parrot pals retriever sofa conure
Rose-Ringed Parakeet (Psittacula Krameri) Common Indian Parrot (Saran Vaid) Tags: pet india color green bird nature beautiful beauty birds rose fauna zoo colorful asia alone dof searchthebest bokeh wildlife indian heinrich beak feathers parrot monk cage best depthoffield exotic poultry pirate sit parakeet punjab kramer soe isolated ringed chandigarh captivity birdwatcher wilhelm awesomeshot indianparrot psittaculakrameri roseringedparakeet ringneckedparakeet psittacula flickrsbest krameri rajpura abigfave canoneos400d platinumphoto avianexcellence flickrdiamond theunforgettablepictures commmon canonefs55250f456is rubyphotographer vosplusbellesphotos wilhelmheinrichkramer
Big Birdy (KoriG) Tags: red pet reflection bird apple yoda parrot reflected reflect parrotlet pacificparrotlet featheryfriday abigfave colorphotoaward
My pretty Girl (ineedathis) Tags: family fab pet bird parrot soe zuzu eclectus takeabow naturesfinest blueribbonwinner supershot anawesomeshot colorphotoaward impressedbeauty ultimateshot superbmasterpiece avianexcellence top20red theunforgettablepictures brillianteyejewel theperfectphotographer goldstaraward
Hello to everyone!!!!!!!!!!!! (vitamar) Tags: friends pet pets cute love birds fauna dinner fun grey friend funny friendship sweet african parrot africangreyparrot africangrey tropicalbirds blueribbonwinner dearfriend avianexcellence diamondclassphotographer flickrdiamond maksinka llovemypic
Punk Parrot (_ shootpics) Tags: pet pets bird nature birds catalina nikon wildlife parrot parrots catalinamacaw nikond2x supershot featheryfriday anawesomeshot impressedbeauty aplusphoto qualitypixels
Happy New Year!!! (KoriG) Tags: eve party pet bird hat glasses necklace beads yoda parrot newyear years 2009 happynewyear parrotlet pacificparrotlet featheryfriday hbw
So sweet! (KoriG) Tags: pet green bird yellow yoda pair parrot mellowyellow 2009 parrotlet naturesfinest pacificparrotlet featheryfriday featheryfriday1 avianexcellence
Skateboard Tricks (KoriG) Tags: pet bird yoda parrot tricks skateboard skater trick parrotlet pacificparrotlet outstandingshots abigfave lmaoanimalphotoaward adoublefave favouritecapture trickbird
we are all ready for bed now (sansanparrots) Tags: friends sleeping pet pets bird birds interestingness friend eating parrot explore parrots conures maroonbellyconure
'love'  or the  'joy of being preened' (sansanparrots) Tags: friends pet parrot pals jordan africangrey parrots preen featheryfriday bareeyecockatoo
Quaker Baby in Extended Childs Pose (nybird) Tags: pet baby green bird yoga kodak feather parrot exotic babybird quaker petbird quakerparrot monkparakeet myiopsittamonachus kodakp850 p850 featheryfriday pixelthis 1007989
Shake it (Kerli'sPhotography) Tags: pet bird colorful parrot cockatiel
Blue Parrot with a Wise Smile (BBMaui) Tags: blue pet pets cute bird nature beautiful birds animals topv111 hawaii topv333 wildlife parrot exotic kauai tropical macaw animalkingdomelite impressedbeauty aplusphoto
Hey, Your Bird is Red! (FoNgEtZ) Tags: pet bird colors philippines parrot davao mindanao golddragon fongetz francistan
Peace this Holiday season (KoriG) Tags: christmas pet bird peace yoda parrot tistheseason parrotlet blueribbonwinner pacificparrotlet featheryfriday hbw 1featheryfriday
Say Hello to Kiwi! (*amy&kimball) Tags: orange pet green bird parrot down curious mustache kiwi upside featheryfriday flickrcolour colourartaward artlegacy
In a bit of a bind (KoriG) Tags: pet bird chicken dinner starwars yoda parrot thats darthvader yaddle clonetrooper parrotlet pacificparrotlet
West stealing my soda and using the straw (pandoraice) Tags: pet pets cute bird birds parrot tricks conure greencheek featheryfriday featherfriday1
peace on earth (eva8*) Tags: christmas pet bird kristina parrot kristi peepers eva8 joytotheworld featheryfriday interestingness154
You have to stretch your tummy... (Ollie_girl) Tags: christmas orange pet sun macro bird yellow eating parrot ollie blueberry practice conure sunconure olliewood impressedbeauty
Look,mom, I'm clean... (sasithorn_s) Tags: pet parrot soe eclectus cubism blueribbonwinner passionphotography golddragon worldbest platinumphoto anawesomeshot ultimateshot goldstaraward rubyphotographer vosplusbellesphotos
camera shy... (daisybaxter) Tags: camera pet bird canon happy parrot shy powershot explore hut richard conure hideout sunconure happyhut featheryfriday explored pet100 sd850
Things are looking up! (_ shootpics) Tags: pet pets bird nature birds nikon wildlife parrot macaw parrots macaws blueandgoldmacaw nikond2x featheryfriday abigfave impressedbeauty aplusphoto lmaoanimalphotoaward goldstaraward
Ollie's a bit "nesty" (Ollie_girl) Tags: orange pet bird yellow circle square happy box parrot ollie sunconure featheryfriday oatmealcarton
Sometime human attention is not enough.. (nathascha) Tags: pet bird pentax crash ottawa parrot moluccancockatoo featheryfriday featheryfriday1 k100d nathascha smcpentaxm50mmf2 jackpurcellcenter
Macaw (Domain Barnyard) Tags: pet bird nature animal interesting colorful wildlife beak feathers parrot 2006 canoneos20d exotic tropical april macaw ara tingey psittacidae largebird domainbarnyard i500 specnature kukadoo april102006 ranked265 psittacinebirds specanimals kakadoochoice
Kisses (ezys) Tags: dog pet sun bird yellow kiss labrador parrot retriever conure featheryfriday
I'm ready for school Mom! (KoriG) Tags: pet bird yoda parrot books backpack 888 parrotlet pacificparrotlet featheryfriday anawesomeshot colorphotoaward avianexcellence schoolbird
Peeking Out (KoriG) Tags: pet bird hole head parrot peek 2009 parrotlet awesomeshot pacificparrotlet



page:          1        2        3 
size:     -      



50 parrot pet 43 bird 28 featheryfriday 16 birds 11 pets 10 parrotlet parrots pacificparrotlet 9 nature wildlife abigfave yoda 8 yellow blueribbonwinner avianexcellence 7 macaw conure impressedbeauty 6 sunconure orange nikon nikond2x friends cute 5 theunforgettablepictures goldstaraward aplusphoto green exotic 4 explore sun colorphotoaward i500 beautiful flickrdiamond ollie theperfectphotographer diamondclassphotographer interestingness colorful anawesomeshot 2009 dog tropical soe 3 fauna platinumphoto beak macaws animal pixelthis africangrey naturesfinest blueandgoldmacaw fun dinner supershot rubyphotographer featheryfriday1 christmas friend feathers

Pairs: 46 parrot,pet 40 bird,parrot bird,pet 27 featheryfriday,pet 26 bird,featheryfriday featheryfriday,parrot 13 birds,pet birds,parrot 11 bird,birds pet,pets parrot,pets birds,pets 10 parrot,parrotlet bird,pacificparrotlet parrotlet,pet pacificparrotlet,pet pacificparrotlet,parrotlet bird,parrotlet pacificparrotlet,parrot 9 pacificparrotlet,yoda bird,pets parrot,yoda parrots,pet birds,featheryfriday parrotlet,yoda bird,yoda pet,yoda 8 parrot,parrots pet,yellow parrot,yellow bird,parrots abigfave,pet 7 impressedbeauty,pet bird,macaw featheryfriday,yoda pet,wildlife parrots,pets featheryfriday,pacificparrotlet macaw,pet nature,parrot conure,parrot bird,impressedbeauty avianexcellence,pet bird,yellow featheryfriday,parrotlet bird,wildlife abigfave,bird abigfave,parrot birds,parrots conure,pet blueribbonwinner,pet bird,nature nature,pet impressedbeauty,parrot featheryfriday,pets featheryfriday,parrots parrot,wildlife 6 pet,sunconure bird,orange avianexcellence,bird nikond2x,pets orange,parrot nikon,nikond2x pets,wildlife nikon,pet nature,wildlife nikon,parrot bird,nikond2x birds,nature orange,pet featheryfriday,nikon nikon,parrots birds,nikon parrot,sunconure macaw,parrot birds,wildlife bird,conure birds,nikond2x friends,parrot bird,sunconure avianexcellence,parrot nature,pets bird,nikon nikond2x,pet friends,pet nikon,pets 5 impressedbeauty,pets nikond2x,wildlife macaw,pets birds,impressedbeauty nature,parrots aplusphoto,bird macaw,wildlife featheryfriday,nature nikon,wildlife featheryfriday,wildlife conure,featheryfriday aplusphoto,nature nikond2x,parrot birds,macaw aplusphoto,wildlife nature,nikond2x aplusphoto,birds aplusphoto,pets nikond2x,parrots blueribbonwinner,parrot macaw,nature aplusphoto,pet parrots,wildlife nature,nikon impressedbeauty,wildlife featheryfriday,nikond2x 4 featheryfriday,sunconure aplusphoto,nikon orange,yellow featheryfriday,impressedbeauty ollie,pet diamondclassphotographer,pet abigfave,wildlife abigfave,birds bird,green goldstaraward,parrot ollie,sunconure ollie,parrot

Users: KoriG 10 _ shootpics 6 Ollie_girl 4 sansanparrots nybird 3 ezys vitamar *amy&kimball eftimov-schenk-schwartz Saran Vaid Fliker_2000 adamantine Domain Barnyard ineedathis Edgar Thissen whatUthinkin eva8* Tanya Mass nathascha sasithorn_s BBMaui Kerli'sPhotography eagle1effi daisybaxter pandoraice FoNgEtZ