strange,weird Flickr Hive Mind weird strange bizarre surreal odd midnightdigital christophedessaigne atmosphere art quirky Pairs: strange,weird bizarre,strange strange,surreal surreal,weird bizarre,weird odd,strange odd,weird christophedessaigne,strange midnightdigital,strange midnightdigital,weird Users: Midnight-digital boopsie.daisy DerrickT Mareen Fischinger ajpscs wip-hairport Sister72 gilderic Bistrosavage CraigMarston stonefaction (more)
New Flickr tool available (for Flickr users): Flickr Black Magic. See your photos on black, easily.
 Recent   Interesting   Timeline   Advanced 
Cosmic Girl (Mareen Fischinger) Tags: mareen mareenfischinger strange weird odd face lips earrings lavender portrait spacy woman green eyes selfportrait starwars purple cosmicgirl cosmic freckles youth funky pink ad
The Miracle and the Sleeper (Midnight-digital) Tags: strange statue square weird artwork bravo solitude alone loneliness desert miracle digitalart dream surreal atmosphere eerie structure dreamy surrealist bizarre progressiverock dreamtheater anotherdimension alarecherchedutempsperdu midnightdigital hourofthesoul artistictreasurechest obramaestra christophedessaigne
peculiar D.N.A. (ajpscs) Tags: street portrait people girl strange face fashion japan hair way out asian japanese tokyo weird eyes nikon asia cosplay streetphotography makeup freaky lips odd harajuku dna  nippon  lipstick d100 queer bizarre extraordinary workit offbeat  streetfashion peculiar wildhair harajukugirl contactlens  uncommon tokyostreets supershot vrlens pedestrianparadise designit ajpscs liveit afsvr18200mm streetsofharajuku harajukugirlsyougotthewickedstyle ilikethewaythatyouare japanesefashionscene expressit commandyourstyle createit moderngeisha subcultureinakaleidoscopeoffashion hangingwiththelocals watchingatyougirls newgeisha brppc07 brpadminschoice
eccentric beauty (ajpscs) Tags: street portrait people girl strange beauty face fashion japan hair asian japanese tokyo weird costume interestingness eyes nikon asia purple cosplay streetphotography freaky explore harajuku  eccentric nippon  d100 queer bizarre extraordinary workit offbeat  peculiar wildhair harajukugirl  viviennewestwood superlovers tokyostreets vjay pedestrianparadise gtaggroup goddaym1 designit utatafeature ajpscs nikonstunninggallery liveit abigfave streetsofharajuku harajukugirlsyougotthewickedstyle ilikethewaythatyouare japanesefashionscene expressit commandyourstyle createit moderngeisha goldenphotographer subcultureinakaleidoscopeoffashion watchingatyougirls starbeauty essenceofharajukugirl newgeisha
Astronaut, Explorer & Dinosaur. (stonefaction) Tags: costumes people strange topv111 geotagged scotland weird crazy bravo edinburgh dynamic dinosaur earth explorer topv999 steps surreal astronaut odd wierd spaceman wtf mad bizarre quirky faved personalfave explored abigfave geo:lat=55950792 geo:lon=3174834 highestposition11ontuesdayaugust292006
holi003 (dogseat) Tags: nyc newyorkcity portrait ny newyork 6x6 film strange nycpb square weird holga colorful flag culture ishootfilm dirty odd queens teen squint gothamist colourful dye hindu redwhiteandblue holi cultural richmondhill phagwa phagwah babypowder beautimous bhojpuri richmondhills
Lingering whispers (Midnight-digital) Tags: bw woman white cinema black tree art nature strange birds silhouette mystery lady clouds photomanipulation dark painting square weird fantastic movement artwork mood surrealism digitalart dream roots dramatic surreal atmosphere muse mysterious imagination crow cinematic drama whispers bizarre enigmatic contrasted thesecretlifeoftrees midnightdigital hourofthesoul obramaestra christophedessaigne
The Tower Of The Mighty God Ubbo-Sathla (Midnight-digital) Tags: mist tower strange dark weird scary fantastic aftermath artwork ancient solitude alone loneliness desert god sinister digitalart apocalypse dream evil surreal atmosphere eerie poetic adventure fantasy madness mysterious horror imagination nightmare feeling mighty bizarre mystic realm endoftheworld grandeur anotherdimension clarkashtonsmith midnightdigital hourofthesoul ubbosathla newromantism christophedessaigne
Medusa I (Midnight-digital) Tags: woman art strange mystery dark hair weird mood dream longhair atmosphere eerie textures mysterious imagination sensuality medusa paganism mythology enigmatic pagan darkhair aod gasmak midnightdigital hourofthesoul christophedessaigne
My Tongue Is A Lizard (JaredPallesen) Tags: portrait selfportrait me strange face tongue photomanipulation photoshop self myself nose weird photoshopped lizard portraiture quirky photomanip lizardtongue jaredpallesen
Veteran of the psychic wars * (Mister Disaster serie 02) (Midnight-digital) Tags: cinema strange hat train dark weird aftermath scenery solitude mood alone character perspective apocalypse dream atmosphere nuclear eerie textures gasmask voyager atomic fallout endoftheworld blueoystercult postnuke strobist afterthebomb midnightdigital christophedessaigne
Eat It Doll Up! (boopsie.daisy) Tags: blue food silly strange breakfast weird yummy crazy diptych funny doll pretty sticky tasty fork stack blond bite syrup waffles wacky bizarre quirky dollhead kooky headonastick auntjemima bradleydoll 10faves
Marshmallows & Coco (boopsie.daisy) Tags: food silly color cute colors strange face toy weird funny colorful doll drink chocolate beverage hotchocolate creepy odd coco marshmallows pastels mug cocoa liquid quirky lots rosycheeks dollhead 25faves
Careful With That Razor's Edge (DerrickT) Tags: me strange fun weird experiments insane blood experiment yay eerie creepy portraiture horror lunatic bizarre blahblahblah manuallabor lovinglife andonandon ifyourecuriousthisisthegreatestbloodformulaevacourtesyofthegreatspecialeffectsmakeupartistdicksmithandhisbrilliance thechocolateonthecornerofmylipicouldsayisdriedbloodbutiwillgoaheadandsaythatiwaseatingtoostierollsbeforedoingthisprojectsmile carefulwiththatrazorsedgeeugene ivefinishedmybeautifulflyingmachine manualspecialeffects neededtoshave myunclehelpedwiththefunofthisproject theheatwasalmostunbearablebutagainisufferforitandifwedontgetitrightthenwedoitoverandoverandoveruntilitshowwelikeit scorsesewouldproudofus thiswasprobablythe15thor20thtakewithvariouslightingtechniques ihadacupoficedteasittingtomyfarrightformuchneededuseduringthisexperiment thecupbecameemptyfartooquickly ireplinisheditshortlyafter whyamitalkingaboutteanowhaha willbeworkingonthismoreinthefuture ineedacuppedhandtoholdmychinupwhisperinginmyearanythingthatlacksuncommonsense
Aranha branca / White spider (VelhoJR) Tags: brazil white macro southamerica strange braslia brasil spider weird dof inho brasilia branca aranha estranho velhojr
Medusa II (Midnight-digital) Tags: woman art strange mystery dark hair weird mood magic dream atmosphere eerie spell spooky textures mysterious imagination sensuality tones magical medusa paganism mythology pagan darkhair sorcery gasmak midnightdigital christophedessaigne
 Nuns have fun 03  (Midnight-digital) Tags: flower strange fun weird religion apocalypse nun christian frame gasmask bizarre aura icone blasphemous postatomic biblic midnightdigital christophedessaigne
Through the magnifying glass (Mister Disaster serie 09) (Midnight-digital) Tags: portrait sky cinema texture strange dark weird aftermath hand fear dream surreal atmosphere eerie retro spooky magnifyingglass psycho disaster tophat frame future gasmask surrealist pulp bomb atomic tones bizarre serie fallout postapocalyptic midnightdigital misterdisaster thedeclineofhumanity niclear christophedessaigne
Please hold the line... (Mister Disaster serie 04) (Midnight-digital) Tags: lighting light strange hat fun weird mood hand phone perspective surreal atmosphere nuclear wideangle tophat scifi gasmask 50s surrealist pulp atomic bizarre serie fallout endoftheworld postapocalyptic postnuke strobist midnightdigital christophedessaigne
The dreamer V.01 (Mister Disaster serie 01) (Midnight-digital) Tags: road art strange birds photoshop weird poetry mood creative dream surreal atmosphere ps pinkfloyd textures tophat gasmask surrealist feeling concept dreamer magical bizarre endoftheworld mythical progressiverock strobist midnightdigital awardtree christophedessaigne
Ciudad de las Artes y de las Ciencias de Valencia (Pichote) Tags: light summer reflection water glass valencia strange museum architecture night noche weird spain arquitectura estate arte arts palace espana calatrava reflejo verano museo palazzo nuit notte architettura sciences valenciana 07 vidrio 2007 palacio vetro vitre riflesso lucena valenciano arenzano comunitatvalenciana abigfave brusasco ltytr2 ltytr1 diamondclassphotographer pichote
Mack-Aroni & Cheese (boopsie.daisy) Tags: mack mac macaroni macaroniandcheese cheese noodles food meal lunch supper doll dollhead boy face freckles peek peekaboo yellow yummy funny creepy spooky kooky cute weird crazy quirky strange silly fun
morbid fascination (odette.h) Tags: eh strange weird ou morbid heik superaplus aplusphoto conclaveobscurum blackribbonbeauty spittinshells ajwe2 chuyabibi 7elw
A Pretest Once (k)New of Th' Polite Circles (DerrickT) Tags: strange amber weird eerie creepy odd bizarre hypnotic psychological dontyou grandiloquence adisciplinetofurnishhermindandenablegraceanywhereonanyoccasion bridgedoneselffromthegapper alongingforacircularquickflop ahyouknow lookingintotheopening whenthebracesofstolengravityleavesthescene pidici impressedbeauty
Self- Reached Within The Internal rching (DerrickT) Tags: blackandwhite selfportrait art me strange photography weird experiments artistic surreal shades odd vision ethereal monkeys dreamy experimentation surrealistic within avantgarde andhappy happinesscomesfromwithin reachandbefree allmanualallmanualexperimentationasusual likeapostmodernclusterofaccountability annihilateyourinternalstruggle imnotaverage butimmodest conceptualisms orism internalarching andyesthatsmyhand
 (/\/\ /\ T) Tags: street city blue green art window water strange rain wall architecture facade germany dresden weird machine trumpet system drain allemagne twisted funnel deutsch siphon dresde kunsthofpassage abigfave
Bodenham; Alternate Version (CraigMarston) Tags: color colour topf25 strange topv111 topv2222 ir weird topf50 topv555 topv333 topf75 topv1111 topv999 arboretum spooky topv5555 craig infrared topv777 unusual topv9999 topf150 topv3333 topv4444 topf100 topf200 marston bodenham falsecolour topv8888 topv6666 topv7777 craigmarston 720nm rafphotocomp2006winneropencategory wwwcraigmarstoncom
Homage to Vivia (Mareen Fischinger) Tags: mareen mareenfischinger tomato mouth alien weird red girl portrait odd strange homage
Whatever Happened to Baby Jane? (Bistrosavage) Tags: bw topf25 strange toy robot weird topv333 doll dolls puppet topv1111 surreal fudge lovecraft nightmare cyborg kafka topf125 asimov poe mueca robotic topv8888 topv7777 tecno mekcoucher topf175 world100f
Coca Lola (boopsie.daisy) Tags: cute glass strange weird doll pretty drink head beverage lola straw coke pop creepy odd soda cocacola quirky dollhead bradleydoll wowiekazowie diamondclassphotographer flickrdiamond
Laundry Day (tainted  dream) Tags: seattle art strange up america john studio photography weird washington university united fine arts barbie shift plastic laundry western sloan bellingham states washed collaborative bratz allied abigfave
Shoes In Strange Places 3 (Lady Vervaine) Tags: street city uk urban strange sepia shoe scotland weird shoes britain glasgow pair surreal trainers gravity converse pairs hanging suspended hang bizarre weightless gravitydefying shoesinstrangeplaces
This is Not a Good Place To Commit Suicide (~ Aaron Reed ~) Tags: bw cliff signs strange sign night oregon dark portland landscape death weird jump suicide drop gravity pacificnorthwest jumper pdx gitzo unfortunate digitalphotography reallyrightstuff landscapephotography canon1022 keepportlandweird beautifullandscape portlandphotography singhray outdoorphotographer aaronreed leefilters landscapephotographer portlandphotographer canon40d traveloregon pacificnorthwestphotography colorfulpictures highqualityphotography vacationoregon aaronreedphotography prettylandscape oregonphotographer portlandoregonweddingphotography portlandweddingphotographer reallyrightstuffballhead portlandoregonphotography portlandoregonphotographer pacificnorthwestphotographer oregonlandscapephotography oregonlandscapephotographer placestovisitinoregon naturehighquality highqualitylandscapeart thingstoseeinportlandoregon thingstoseeinoregon httpaaronreedphotographycom colorfullandscapes pacificnorthwestlandscapephotography professionallandscapephotography httpwwwaaronreedphotographycom singhrayneutraldensityfilters oregonwashingtonphotographer oregonwashingtonphotography
hair cut hairdesign "the eye" (wip-hairport) Tags: haircut color eye girl strange face fashion illustration hair de design weird lisboa corte style wip freaky odd independent radical eccentric salon lissabon queer extraordinary cabelo styling offbeat haare peculiar antifashion haarschnitt gefrbt cabeleireiro hairart hairport wiphairport individualstyle
Bee-witched (boopsie.daisy) Tags: autumn silly fall halloween window strange hat wonderful bug insect buzz fun weird fly costume wings october funny wasp boots bokeh witch stripes dressup insects bugs bee odd pane decorate wacky quirky broomstick kooky blueribbonwinner supershot outstandingshots 25faves abigfave anawesomeshot isawyoufirst superbmasterpiece wowiekazowie diamondclassphotographer flickrdiamond theperfectphotographer happinessconservancy
Fruit Lou (boopsie.daisy) Tags: food baby silly color colors strange face breakfast louis weird yummy funny colorful doll head peekaboo cereal creepy spooky delicious lou multiple quirky lots kooky fruitloops
Spag Eddie (boopsie.daisy) Tags: food silly color colors strange face dinner ed weird yummy funny colorful doll head sauce peekaboo pasta creepy spooky edward delicious noodles multiple eddie supper spaghetti quirky lots kooky
Ebullient Eye-opener Inside of A Jagged Ladder's Cerebellum (DerrickT) Tags: strange weird peekaboo nophotoshop eyeopener avantgarde multivision loudsilencessurroundinghumanartifacts glassespoke ladderletsmecurlupinsideofitsribcage derrickhasmanyfangirlsiampleasedtobeonemyself saysolive
Delusion Fields (Midnight-digital) Tags: brazil sky man tower strange mystery photomanipulation dark weird artwork solitude alone loneliness surrealism horizon digitalart dream surreal atmosphere eerie structure dreamy surrealist bizarre dreamcatcher impossible blocs anotherdimension midnightdigital christophedessaigne alareche4rchedutempsperdu
the mask of madness (self contained portrait) (onkel_wart) Tags: portrait blackandwhite bw me strange self canon hair square eos weird crazy mask sigma 11 dirty madness sw ich unshaven 1x1 mental selbst maske quadratisch haar wahnsinn 500x500 notshaved dreckig verwirrt irrsinn wirr unrasiert schwarzundweiss 400d sigma1770mmf2845dcmacro artlegacy schwarzundweis 500x500bw6 500x500selfportraits format1x1 typebw
Cuke Amber (boopsie.daisy) Tags: food silly cute green strange face fun amber weird crazy doll head peekaboo cucumber kitsch vegetable multiple series peek veggie peeking wacky quirky lots kooky
Mr. Collage-Man's Orbly Stare (DerrickT) Tags: selfportrait me strange scarf fun weird experiments funny experimental mask surreal oxygen sequence comical papermache avantgarde thesoftenergythatfollowshimswiftly theideatobecomeacollage itallstartswiththis likeacosmicconversation tuckedbetweenthefoldsofmymind butterfliesonmyface twohandsforeacheyebrow selfcollaged
hairdresser ins front (wip-hairport) Tags: new red haircut color strange lady hair design weird cool punk lisboa lisbon haridresser longhair style queen radical newhaircut queer haircuts styling stylist dyedhair cabelos hairdesign cabeleireiro wiphairport
Jukebox on the Beach (Sister72) Tags: november music beach strange weird smog video interestingness sand smoke awesome nj odd jukebox monmouthcounty unusual musicvideo springsteen 2007 oceangrove 123nj
Monkeys on a Banana (Furryscaly) Tags: original food 6 white macro cute art strange yellow closeup fruit pen ink work weird sketch office interesting funny different drawing lol unique creative bored boredatwork banana boredom explore whitebackground doodle irony monkeys highkey unusual slack draw amusing peel ironic freetime six musa bizarre inkpen bananapeel comical slacking countertop clever ballpoint whiteground primates hikey eyecatching ballpointpen toomuchfreetime bananaskin slackingoff bananayellow tacomaartmuseum sixmonkeys yellowbanana monkeysonabanana governmentjob smalldraw
A Potency For Unknown 'Knowns' (DerrickT) Tags: blackandwhite strange mystery amber weird experimental sister surreal odd bizarre avantgarde psychological abigfave dontthinkofitasbeingwhatyouthinkitmaybeordontthinkitis becauseitmaycomebackandbiteyouonthebuns ohhowiloveit imustadmitthatithinkthatitlovesmeaswell somewhatofapanicbutnotreally tensionbehindthewindow somethingthathappenedbeforethis impressedbeauty
Jane Wynn- Hands (Jane Wynn) Tags: strange weird hand surreal odd curious
The dreamer V.02 (Mister Disaster serie 03) (Midnight-digital) Tags: road blue art strange birds photoshop weird poetry mood creative dream surreal atmosphere ps pinkfloyd textures tophat frame gasmask surrealist feeling sight concept oniric dreamer magical bizarre serie endoftheworld mythical progressiverock strobist midnightdigital christophedessaigne
"Okay - you're weird!" (nerdvin) Tags: dog 20d girl strange smile look canon puppy fun nose happy weird eyes funny joy chantale anawesomeshot diamondclassphotographer flickrchallengewinner lmaoanimalphotoaward
The Petrified Paparazzi (gilderic) Tags: street city urban sculpture art girl strange statue modern corner lumix weird funny europe cityscape photographer panasonic paparazzi slovensko slovakia bratislava ville attraction insolite touristic slovaquie instantfave gilderic aplusphoto



page:          1        2        3 
size:     -      



50 weird strange 18 bizarre 15 surreal 14 odd 12 midnightdigital christophedessaigne 11 atmosphere 10 art quirky face funny dream 9 eerie 8 dark doll fun portrait 7 silly creepy abigfave food mood hair 6 surrealist kooky spooky color girl gasmask 5 me endoftheworld peekaboo street mystery textures cute crazy 4 tophat lots selfportrait eyes hourofthesoul artwork alone digitalart mysterious avantgarde square solitude yummy woman dollhead diamondclassphotographer queer colorful imagination head bw strobist 3 hat cinema progressiverock birds fashion extraordinary people fallout hand unusual city green frame white photomanipulation amber experiments peculiar atomic blackandwhite apocalypse serie creative colors photoshop multiple loneliness feeling wacky aftermath dreamy anotherdimension magical offbeat blue freaky

Pairs: 36 strange,weird 12 bizarre,strange strange,surreal 11 surreal,weird bizarre,weird 10 odd,strange odd,weird 9 christophedessaigne,strange midnightdigital,strange 8 midnightdigital,weird atmosphere,strange quirky,weird art,strange art,weird quirky,strange christophedessaigne,weird 7 doll,strange atmosphere,weird eerie,weird eerie,strange dream,strange funny,strange doll,weird 6 creepy,weird color,strange food,quirky color,weird funny,weird food,strange dream,weird face,weird mood,strange fun,strange face,strange creepy,strange food,weird fun,weird doll,food food,silly 5 christophedessaigne,mood food,funny face,quirky gasmask,strange silly,weird silly,strange food,kooky atmosphere,mood quirky,silly portrait,weird doll,silly portrait,strange strange,textures strange,surrealist face,food mood,weird midnightdigital,mood 4 food,yummy art,mood abigfave,strange mystery,strange peekaboo,weird kooky,weird selfportrait,weird dark,eerie doll,funny art,atmosphere head,weird christophedessaigne,dark lots,silly face,lots art,christophedessaigne face,silly food,peekaboo kooky,silly gasmask,weird doll,quirky dark,weird mood,textures avantgarde,strange color,face art,textures funny,silly kooky,strange creepy,food textures,weird me,weird funny,quirky surrealist,weird mystery,weird dark,strange head,strange food,lots art,midnightdigital dark,dream dream,mood lots,weird doll,face atmosphere,dark dark,midnightdigital avantgarde,weird peekaboo,strange art,dream

Users: Midnight-digital 12 boopsie.daisy 8 DerrickT 6 Mareen Fischinger ajpscs wip-hairport Sister72 gilderic Bistrosavage CraigMarston stonefaction Furryscaly onkel_wart dogseat nerdvin Lady Vervaine tainted dream Pichote VelhoJR ~ Aaron Reed ~ odette.h JaredPallesen Jane Wynn