value (Tags) Flickr Hive Mind Tags: value photography photos hue flickr saturation contrast luminosity fotos saturación Pairs: art,value beauty,value red,value time,value canon,value life,value bw,value 200,fuji 200,pro value,yes Users: ponchosqueal° LegoLeah Molly Quist edwardolive .. ethαnea filipinoj Kayak49 T Glow agrinberg mrtambourine Faithful Chant (Zeitgeist)
If you can't bite, don't show your teeth. (ponchosqueal°) Tags: pink red detail macro closeup méxico contrast tooth mouth mexico photography rojo nikon flickr alfonso braces photos teeth rosa mexican fotos serenity saturation value dentist rgb boca hue poncho brightness brackets mexicano diente brillo dientes dentista valor fotografía luminosity saturación luminosidad nikond80 bracels ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia
STOP MASSACRE! (ponchosqueal°) Tags: red portrait girl méxico contrast mexico photography interestingness interesting rojo bravo flickr alfonso braces photos retrato top gorgeous pop niña fave explore mexican fotos serenity saturation faves 100 value popular rgb incredible medusa hue poncho grito brightness brackets mexicano shout brillo valor fotografía peopleschoice luminosity saturación cotcmostinteresting cotcmostfavorited magicdonkey 100faves explored luminosidad bracels ponchosqueal ponchosqueal° mexicanphotographer bestbravo raziks20 alfonsocontrerasampudia flickrjobdiff 11pca
Pigs in Zen (ponchosqueal°) Tags: food méxico contrast dead mexico fire photography death pain flickr alfonso photos toast flames tasty mexicanfood pork mexican charcoal fotos serenity pigs saturation peta mean value fuego asado coal veracruz fried rgb hue poncho brightness mexicano llamas roasted meanie mexicanrestaurant brillo cochinita valor fotografía cerdos luminosity saturación title2 cochinos carbón puercos title3 yambo title1 titleit luminosidad marranos yanga ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia
Orion (MaiKoh) Tags: horses horse caballo caballos spanish pre value chiaroscuro stallion equine andalusian equus claroscuro andalucian tenebrismo spanishbreed tenebrism purarazaespañola iberianhorse hbotw fnmc2
Endless Time (¶î®åt_khan_leo) Tags: nyc usa ny colors us time sony precious value endless tagore sobeautiful blueribbonwinner beautysecret inspiredbylove bej totalphoto diamondclassphotographer flickrdiamond thatsclassy betterthangood theperfectphotographer flickrestrellas llovemypics
gaudi coins (Casa Batlló) (mrtambourine) Original Available.  Tags: barcelona art tag3 architecture tag2 colours tag1 coins tag awesome curves value outlines gaudì casabattlò diamondclassphotographer flickrdiamond superhearts
the principles of the divine (TheAlieness GiselaGiardino²³) Original Available.  Tags: life beauty handwriting reflections words quote napkin grace divine intelligence thoughts law lefty value universe survival arthurcclarke 2007 needless logic phenomenon aesthetic tautology may28 thinkaloud dontfreakout eclecticthinker thinkbigdobiggest
Cookies! (Kayak49) Original Available.  Tags: girls red green cookies coconut chocolate 2006 future strength value girlscouts girlscoutcookies peanutbutter girlguides dosido samoas thinmint cafecookies
What do I value in my life? (Lú_) Tags: red signs toronto ontario canada college window wall architecture words university interiors hole picturesthroughholes interior elevator posters value colleges uoft values universities univerityoftoronto explored
 (borrowed time | demi-brooke) Original Available.  Tags: above girls summer night sisters bathroom one hand brooke pearls her numbers ten wait late demi worth value far facebook thirty proverbs rubies explored photosharepodcastcom
0y (CloudMan82) Original Available.  Tags: art beauty writing justice peace muslim islam faith oppression arabic health value calligraphy wisdom success injustice allah ruling values
All Star (ponchosqueal°) Tags: longexposure black 30 méxico mexicana contrast vintage mexico photography shoes long flickr alfonso photos negro preto best zapatos mexican tennis fotos converse serenity saturation pro value rgb hue poncho brightness mexicano melhor mejor brillo obscuro valor oscuro fotografía calzado peopleschoice luminosity saturación marfil mármol magro curo coverse ténis smallaperture luminosidad ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia
5 Yellow. Infinite Green. (ethαnea) Tags: road above paris france color colour green texture colors grass lines yellow composition contrast digital canon photography eos view image geometry feel stripe aspiration may shapes experiment plan scene surface daily minimal line explore direction numbers esplanade urbannature wise contraste strong subject abstraction value ideal curve placement shape asphalt visual ideas hue arrangement tone minimalist infinite element circular ligne linear communicate contemplation rectangular défense overall curving abstracted formes discontinue limiting darks simplification midtones urbannatureblog minimalismdigitalphotography
La rotonda (Come on God, do I seem bulletproof?!) Tags: sardegna canon eos long exposure teddy time bubi rotonda di value 2008 tempo lunga esposizione 450d priorità
365/39 Seven Deadly Sins Day 5 ~ Pride.. (Kezzaroo) Tags: selfportrait me beauty face self nose blood cut narcissism vanity knife pride sin blade value plasticsurgery dignity scalpel cosmetic spt sevendeadlysins 365days cutoffyournosetospiteyourface
Post it everywhere! (ponchosqueal°) Tags: aniversario detail love car méxico mexicana contrast mexico photography fantastic couple flickr alfonso jeep photos amor anniversary pair postit lovers tires covered fotos pollution serenity saturation surprise leisure van value lovely rgb aniversário hue poncho brightness mexicano ocio annoying 3m patience sorpresa brillo valor fotografía ñoño luminosity saturación paciencia cubierto luminosidad ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia mexican frustrante
[Abstract art is] a product of the untalented. (ponchosqueal°) Tags: red abstract art méxico contrast mexico photography rojo flickr alfonso angle photos perspective mexican fotos serenity saturation value rgb hue poncho brightness mexicano brillo valor fotografía utterly luminosity saturación untalented luminosidad ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia
Colmena (ponchosqueal°) Original Available.  Tags: texture textura méxico mexicana contrast mexico photography interesting flickr alfonso photos unique union mexican fotos serenity saturation value sequence miscellaneous sponge rgb honeycomb hue poncho brightness mexicano pvc rythm ritmo colmena brillo valor tubos fotografía luminosity ductos saturación secuencia tepotzotlán luminosidad nikond80 ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia trypophobia
Invaluable (CharlieBrown8989) Tags: people closeup canon spider yahoo interestingness flickr crystal watch picasa best explore timepiece present tele value macros product tamron charliebrown8989 tissot corel charliebrown8989smacro invaluable mydads paintshopproxi
Ao Mar (Pillmann) Tags: brazil blackandwhite bw brasil canon fuji 28mm pb 200 pro fujifilm value santacatarina pretoebranco fujiprovalue200 canoneos500 bwphotoaward pillmann
Access (LegoLeah) Tags: feet female diploma five yes birth mother 25 labels years value protection ambition insides priorities facts transient straighttalk selfworth oflife
cod with mamiya almonds (edwardolive ..) Tags: life wedding españa food fish cinema blur colour art mamiya film water dinner painting de photography spain artwork 645 kiss photographer dof arte image photos bokeh candid stock salmon bank plate diner social andalucia canvas retratos event rights fotos agency almonds oil davidhockney medium format value pescado mariage andalusia zero cena almeria medio novios fotografo spontaneous unplanned licensing eventos sociales photographe formato 80mm comuniones retratista lienzo f19 sekor bautismos underrated m645 undervalued edwardolive fotografodebodas notvalued
Awards up the Wazoo (agrinberg) Original Available.  Tags: flickr award awards value recognition comments toomany rant wazoo curmudgeon stringsattached howcanitbe awards3 thebestphotographintheuniverse noanimatedicons
Marlin (T Glow) Tags: seascape great production value
converse (ponchosqueal°) Tags: black verde green cakes blackbackground bulb méxico cheese contrast mexico fire photography fridge delay flickr alfonso photos negro royal statues pot queso hersheys fotos converse serenity estatuas saturation syrup tabasco value freezer rgb timer hue poncho brightness mexicano parmesan magnolias kraft brillo valor fotografía bulbo luminosity saturación levadura pasteles marfil mármol magro harina smallaperture luminosidad ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia mexican
yahoo! - group b (pbo31) Original Available.  Tags: sanfrancisco california ca city nightphotography bridge red urban usa money color classic up sign northerncalifornia electric night circle lights star bay yahoo big san neon power bright streetsign flash internet stock ad citylife progress before off billboard company just nighttime single sanfranciscobayarea redball bayarea catch brightlights value flashing northern 80 vacancy honk bigcity frisco californian nyse fuse roadway baycity personals reddot fogcity citybythebay circut bluechip revolve cityliving bigcitylights sanfranciscan electricbill capitalisim neoncolor powerbill fourtune500 noyahoos uranlife
Can You Reach the Top? (Molly Quist) Tags: life lighting family light shadow red roses white black color green love me water glass beautiful beauty up rose metal vent photography is bottle amazing still perfect bright wine you photos lock surrealism background bottom great steps deep surreal award next hose molly professional most negative photographs fragrant letter romantic precision orinda value elegant spout hatred popular non powerful piping hdr winning distracting spotless quist romanticism i not impressedbeauty
Valentines Card (sburn01) Tags: humour valentine tesco notbyme value
Tata Nano - ( View In Large Size) (bbjee) Original Available.  Tags: india colour car yellow digital speed cool automobile colours photographer indian tata wheels picture autoshow olympus photograph colourful value nano siam coolest digitalphoto carshow wiki newdelhi motorshow minicar cii genevamotorshow supershot indiancar rearengine genevaautoshow 650cc digitalcamara tatamotors ratantata onelakhcar 2500car olympussp550uz autoexpo2008 olympusdigitaldigitalcamera photographycolours indianphoto geneva2008 wordlscheapestcar tatanano nanoimage nanopicture onelaccar pertolcar tatananolaunch genevaautoshow2008
A Cottage Industry (Finntasia) Tags: flowers houses england garden kent spectrum traditional bloom british names value popular cottages thecottage trottiscliffe karmapotd sourcevariousmousepricecom georgecottage
Don't Vote02 (Ravages) Original Available.  Tags: work advertising poster shock mywork value vote elections campaign chandrachoodan copywriting gopalakrishnan
monetary value (ajpscs) Tags: street people bw money japan japanese tokyo blackwhite nikon chiba change 日本 nippon 東京 blkwht d100 value yen creditcard monetary 千葉県 1000yen 車掌 monokuro ajpscs kominatotetsudou goistation shashou
Whatever thy hand findest to do, do it with all thy heart. (ponchosqueal°) Original Available.  Tags: méxico mexicana composition contrast mexico photography interestingness interesting flickr catholic alfonso christ cross god photos religion jesus bestviewedlarge christian mexican cruz fotos crop serenity sin saturation value cristo miscellaneous rgb hue poncho religions brightness mexicano christians cristiano jesús dios pecado jesuschrist deus brillo valor fotografía gestalt peopleschoice jesucristo luminosity cristianos saturación religión catholics crucificado explored tepotzotlán luminosidad nikond80 ponchosqueal ponchosqueal° mexicanphotographer alfonsocontrerasampudia crossified
ruined (the inhabitant) Original Available.  Tags: poverty original art beauty price death movement mine thought artist action signature rich fame nobody appreciation special creation talent mind yours knowledge choice value rare visionary opinion wealth signed ownership dislike objective layman subjective ordinaryhuman
Creep (rougerouge.) Tags: trees light mist art water 30 river 350d rebel xt eau long exposure time rivière creepy explore exposition arbres shore value brouillard seconds tougas
HDR  - how to make one and why (Mixmaster) Tags: autumn light fall make norway stone night photoshop dark geotagged norge interestingness high october exposure raw foto dynamic cs2 path review norwegen file images number cobblestone explore single link gateway how why jpg guide bergen value setting jpeg comparison technique range mathematical hdr highdynamicrange explanation tutorial hordaland settings norvege tonal exposures bracketing cs3 photomatic stort rosenkrantz tonemapped bredt tonemap teknikk vidt dynamisk akam akamno omfang
Lord Krishna's painting - The Times of India Kala Ghoda Arts Festival, Mumbai - India (Humayunn N A Peerzaada) Tags: lordkrishna painting paintings thetimesofindiakalaghodaartsfestival mumbai india the timesofindia kalaghodaartsfestival wwwhumayooncom humayun humayoon humayunn humayunnnapeerzaada humayunnapeerzaada peerzada peerzaada maharashtra model actor photographer kutch madai kudachi kudchi deolali kalaghoda thetimesofindia httpmfpaindiacom mfpa mouthandfootpaintingartists handicapped handicappedartists rehabilitationthroughtheirart rehabilitation art selfhelporganisation selfhelp organisation disabledartists disabled artists worldwideassociationofmouthandfootpaintingartists draw paint brush foot mouth toes cards calendars designs artisticmerit valueformoney artistic merit value money work purchase financialindependenceforlife creative selffulfillment financial independence life self fulfillment mfpaartistspvtltd jsw surfexcel manjibhailramani
Sand Christ (Rodrigo Neves) Tags: sculpture beach sand fuji christ cross prayer praying jesus 200 pro zenit value niterói 135mm icaraí f35 12xp berolina westromat iscogÖttingen
Yellow Isosceles Triangle (ethαnea) Tags: road above paris france color texture geometric yellow composition contrast digital canon photography eos 350d triangle nanterre view geometry parts aspiration may shapes experiment plan scene surface minimal direction esplanade saturation area abstraction value ideal placement visual ideas hue arrangement tone element idf equality bitume linear 2007 communicate contemplation défense puteaux geometrie abstracted isosceles courbevoie formes hautsdeseine limiting asphalte darks simplification midtones
'music that takes up the energies and the bodies and the hearts and the souls and the time and the minds of young men who give what they have to it and give everything they have to it' (Tones08) Tags: creative believe punkrock create value mogwai aplusphoto hourofthesoul pissoffalldetractors
rainy night dyptich (edwardolive ..) Tags: madrid camera blue people blur art film price night 35mm vintage photography noche calle spain focus shadows dof arte hole gente artistic photos kodak bokeh olive inge olympus wrong edward negative edge scanned worth value om cuanto 3200 castellana portra om2 gens fotografo sprocket artistico cuesta anonymity precio fotografos kelvins tunsten fotosartisticas fotografiaartistica 100t expied edwardolive commercialphotographers fotografiaartisticamadrid fotosartisticasmadrid fotógrafoartisticomadrid photosbyedwardolive fotostomadasporedwardolive fotografoscomerciales
Disappearance/Appearance (PrASanGaM) Original Available.  Tags: life sea inspiration game love silhouette reflections search truth humanity faith appreciation seva value gratitude prayers appearance studies timetable lessons answers manan fadingmemory rashomon dreamorreality redirection pragat nidfilmclub disapperance calcuttajoyunahoyetauswapnamakeviriteave beguilingtruth kingjanakaskedthisquestionandhegotanswer whyiamlisteningtostrangerinmoscowwhyrashomonwhyiuploaddthisimageonlywhoisinspiringmesoperfectly olordinspiremethatipleaseswamistudywellanddontmissswamiaslovehimlotthesedaysandthencrylot strangerinmoscow mistakesgetrepeatedinlifetopresentinlifesamelessonsuntillearnt valuequestions kankariyegayanatanemelobharayonato eternalquestionsoflife mesoluckyneveraskedassuchbutpurvebhagwaanemumukshukhortaneajebhagwaanmumukshunekhoreche sarvakartahartalordswaminarayan mechildofswamibapa lovemattersnothingelsematterstome nirantarsarvekriyamapaachhavarinejoujehunshukarvaavyochunneshunthaychhe purnakaampanu
The Love Letter (Molly Quist) Tags: life lighting family light shadow red roses white black color green love me water glass beautiful beauty up rose metal vent photography is bottle amazing still perfect bright wine you photos lock surrealism background bottom great steps deep surreal award next hose molly professional most negative photographs fragrant letter romantic precision orinda value elegant spout hatred popular non powerful piping hdr valentinesday winning distracting spotless quist romanticism february14th i not sfchronicle96hrs
 (LegoLeah) Tags: life winter woman plant dead spring truth waiting hand yes deception dirt value fertility bellybutton purpose judgement meaning hold
business man with a dollar symbol (filipinoj) Tags: travel boss two usa man money reflection guy sign illustration america silver circle grey us 3d commerce graphic coins earth render cent united rich young bank cash business countries dollar change states value economic manager financial economy exchange economics currency coppers rendering banking dollars wealth finance millionaire accountant monetary currencies finances fiscal denomination denominations
EL CLIENTE DORMIDO (ponchosqueal°) Tags: haircut méxico mexicana contrast mexico photography fan football américa nikon flickr alfonso photos culture mexican barbershop fotos serenity barber saturation posters neat value veracruz rgb córdoba hue poncho brightness mexicano cultura fútbol pelo chivas brillo bussiness valor afiches fotografía peluquería luminosity saturación negocio aficionado subjectmatter luminosidad nikond80 ponchosqueal ponchosqueal° mexicanphotographer neatstore alfonsocontrerasampudia
1000 euro balcony (multi_everything) Tags: life old urban money green interestingness energy colorful bills terrace euro decay hometown balcony bosnia explore veranda laundry towels worth balkans value catchy cdp samac topphotoblog wowiekazowie thosearereallybig500eurobillshangingthere topphotoblogpool topphotoblogselected topphotoblogvote27 eeecotourism
Identity (Faithful Chant) Original Available.  Tags: portrait blackandwhite bw scarf photography eyes pattern religion culture identity awards value tradition retouch retouched norm bwdreams arabculture passionphotography karmanominated ysplix theperfectphotographer faithfulchant micartttt ysplilx
The Lagoon Nebula (spaceman8815) Original Available.  Tags: ocean blue light sea wallpaper sun moon white abstract money black reflection art texture nature metal night clouds america wonderful dark lens stars coin shiny mare shine symbol render space satellite united alien deep science astro system cash business telescope galaxy fantasy cents nebula crater astrophotography round dollar planet scifi quarter planets astronomy planetary states outer value astral lunar orbit starry currency axis twenty constellation finance galactic rotate starfield valuable
beatles (from a second story.) Original Available.  Tags: stain rock modern paint glow folk song jazz tint heavymetal swing melody cast shade harmony soul saturation coloring classical rap value tune bebop blush dye piece popular measure hymn iridescence hue tinge rockandroll bop intensity strain refrain chroma coloration tincture ragtime luminosity colorant complexion undertone pigmentation chinmusic chromatism chromaticity polychromasia tinct chromism washbeatlesair
.
page:  1   2 
size:  - 

Tags: 50 value 17 photography 14 photos 13 hue 12 flickr saturation contrast 11 luminosity fotos 10 saturación fotografía luminosidad brillo serenity mexicanphotographer rgb méxico mexican mexicano poncho mexico alfonso ponchosqueal ponchosqueal° brightness valor alfonsocontrerasampudia 9 art 8 red life 6 beauty green explore money 5 light popular interestingness black mexicana canon color night 4 nikond80 explored texture water love 3 me interesting people deep photographer bright yellow digital exposure white eos award negative bw worth hdr colour composition up nikon metal rojo long great time peopleschoice pro usa above

Pairs: 5 art,value 4 beauty,value 3 red,value time,value canon,value life,value bw,value 2 200,fuji 200,pro value,yes fuji,value value,words blackandwhite,value girls,value 200,value people,value green,value exposure,value architecture,value blackandwhite,bw long,value money,value exposure,long pro,value flickr,value exposure,time hand,value awards,value fuji,pro long,time art,beauty flickrdiamond,value

Users: ponchosqueal° 10 LegoLeah Molly Quist edwardolive .. ethαnea filipinoj Kayak49 T Glow agrinberg mrtambourine Faithful Chant borrowed time | demi-brooke MaiKoh PrASanGaM bbjee Pillmann rougerouge. Rodrigo Neves sburn01 Kezzaroo multi_everything Tones08 spaceman8815 CharlieBrown8989 pbo31 Lú_ the inhabitant TheAlieness GiselaGiardino²³ CloudMan82 Come on God, do I seem bulletproof?! Ravages from a second story. ajpscs Finntasia ¶î®åt_khan_leo Mixmaster Humayunn N A Peerzaada #